KEGG   Erythrobacter sp. YH-07: DVR09_03875Help
Entry
DVR09_03875       CDS       T05587                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
err  Erythrobacter sp. YH-07
Pathway
err00564  Glycerophospholipid metabolism
err01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:err00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DVR09_03875
Enzymes [BR:err01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DVR09_03875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 FAD_oxidored NAD_binding_8 3HCDH_N GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AXK41580
UniProt: A0A345YCC8
LinkDB All DBs
Position
complement(774474..775961)
Genome map
AA seq 495 aa AA seqDB search
MSAIYDLLVIGGGINGAGIARDAAGRGMRVLLVEKDDLASHTSSASTKLVHGGLRYLEHY
EFRLVAESLREREVLLRNAPHIIWPLRFVMPHEPTMRPKWMLRLGLVLYDRIGGKMSLPR
SKRVDLRIAPHRGVLQDRLAAGFEYSDCWVEDARLVVLSAKDAEERGAEVLVRTECTDLE
RSAESWSAALRDKEGERKVSARAVINAAGPFVDRVAKVALGQGTPAHLRLVKGSHIIVSR
RFPGEHAYIFQQPDGRIVFAIPYERDFTLIGTTDLLHEGNLDAVRISDEETRYLCDAASR
YFASAITVEEIASTYAGVRPLYEDNAASNSTVTRDYVFELEAEGGAPILSVYGGKITTYR
KLAEHALDRLGKVLALPGKPWTAHAPLPGGDMPDGDFAAFLWRASERYSWVPPEMLLRLA
RAYGTRMDRVLGTATSLDDLGQDFGGTLFEAELRYLVDQEFARTAEDALWRRSKLGLHLP
TQARQAVAEWFAARA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatttacgaccttttagtcatcggcggcggcatcaacggcgcggggatagcg
cgcgatgccgccgggcgcggcatgagggtgctgctggtcgagaaggacgaccttgcttcg
cacacctcctcggccagtaccaagcttgtgcatggcggtttgcgctatctggaacactat
gaattccgcttggtcgcggaaagcctgcgcgagcgcgaggtgctgctccgcaatgcgccg
cacatcatctggccgctacgcttcgtcatgccgcacgaaccgacgatgcggccgaaatgg
atgctacgactcggacttgtgctctacgatcgcatcggtgggaagatgagcttgccgcgt
agcaagcgcgtggacctgcgcatcgcgccgcatcgcggcgtgctgcaggaccggcttgcg
gcggggttcgaatattcggactgctgggtcgaggacgcccgcctggtggtactgagcgcc
aaggacgcggaagaacgcggagcagaggtcctggtgcgcaccgaatgcaccgatctcgag
cgctccgccgaaagctggagcgccgctctgcgcgacaaggagggcgaacggaaggtctcc
gcgcgcgcggtcatcaatgccgccggtcccttcgtcgaccgggtggcgaaggtcgcgctt
ggccaaggcacccccgcccacctccgattggtcaagggcagccatatcatcgtctcgcgc
cgatttcccggcgagcacgcctatattttccagcagcccgatggccgcatcgtcttcgcg
atcccttacgagcgcgatttcacgctgatcggcaccaccgatctgctgcatgaaggcaac
ctcgatgcggtgcgcatttcggatgaggaaacgcggtatctatgcgatgcggcctcgcgc
tatttcgccagcgcgataaccgtggaggagatcgcctcgacctatgctggcgtgcgcccg
ctctacgaagacaatgccgcgagcaattcgaccgtgacccgcgactatgtcttcgaactg
gaagcagagggcggcgcaccgatcctgtcggtctatggcggcaagatcaccacctaccgc
aaacttgccgaacatgcgctcgacaggctgggcaaagtgctcgccctacctggcaagcca
tggaccgcgcatgcgcccctgcccggcggagacatgcccgatggcgatttcgccgccttc
ctctggcgcgcgagcgaacgctattcctgggttccgccggagatgctgctgcgtctcgcg
cgtgcctatggcacacggatggacagggtgctcggcacagcgacatcgctcgacgatttg
gggcaggatttcggcggaacgctgttcgaagccgagctgcgctatctcgtcgaccaggaa
tttgcgcgcaccgccgaagacgctctctggcggcgcagcaaactcggcctccatctgccc
acccaagcgcggcaggcagtcgccgaatggttcgccgccagggcgtaa

DBGET integrated database retrieval system