KEGG   Erythrobacter sp. YH-07: DVR09_06345Help
Entry
DVR09_06345       CDS       T05587                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
err  Erythrobacter sp. YH-07
Pathway
err00473  D-Alanine metabolism
err00550  Peptidoglycan biosynthesis
err01100  Metabolic pathways
err01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:err00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DVR09_06345
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DVR09_06345
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    DVR09_06345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:err01011]
    DVR09_06345
Enzymes [BR:err01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DVR09_06345
Peptidoglycan biosynthesis and degradation proteins [BR:err01011]
 Precursor biosynthesis
  Amino acid ligase
   DVR09_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AXK42013
UniProt: A0A345YDL1
LinkDB All DBs
Position
1308736..1309710
Genome map
AA seq 324 aa AA seqDB search
MTDLPKLHIAVLMGGWANERPVSLMSGEGVAKALEERGHTVSRIDMDRQVAARIAEAAPD
VVFNALHGVPGEDGSVQGMLDLMGIAYTHSGLATSVIAIDKQLTKQALVPHGIPMPGGRI
VKSADLFERDPMPRPYVLKPVNEGSSVGVAIVTDEGNYGNPIARDAKGPWQDFAELLAEP
FIKGREMTTAVVDFEDGPRALAVTELKPKSGFYDFDAKYTDGMTDHVCPAEIPANIEKLC
LDYALKAHRLLGCRGTSRTDFRWDEEQGEEGLFILETNTQPGMTPLSLVPEQGRHAGIEY
GELCELVVAAALRHHAAKSGDGDG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctccccaaactccatatcgccgtgctcatgggcggctgggcgaacgagcga
ccggtaagcctcatgtcgggcgagggcgttgccaaagcgctggaagagcgcggccacacg
gtgtcgcggatcgacatggaccgtcaggtggccgcgcgcatcgcggaggctgcgcccgac
gtggtgttcaatgcgctgcacggcgtgccgggcgaggatggcagcgtgcagggcatgctc
gacctgatgggcatcgcctatacccattcgggcctggcgacctcggttatcgccatcgac
aagcaactgaccaagcaggcgttggtgccgcatggaatccccatgcccggcgggcgcatc
gtcaaaagcgcggacctgttcgagcgcgatccgatgccgcgcccctatgtgctcaagccc
gtcaacgagggcagttcggtcggggtggccatcgtcaccgacgaaggcaattacggcaat
cccatcgcgcgcgatgccaagggtccgtggcaggacttcgcggaattgctggccgaaccc
ttcatcaagggccgcgaaatgaccaccgcggtggtggatttcgaggacggtccacgcgcg
ctcgcggtgaccgaattgaaacccaaaagcggtttttacgatttcgacgcgaaatatacc
gatggcatgaccgatcatgtctgccccgccgaaatccccgcgaatatcgagaagctgtgt
ctggactacgcgctcaaggcccataggctgcttgggtgccgtggcacgagccggaccgac
tttcgctgggacgaggaacagggcgaagagggcttgtttatcctcgagaccaacacgcag
ccgggcatgacaccgctcagcctggtgccggaacagggcagacatgccggcatcgaatat
ggcgagctgtgcgagctggtcgtggctgcggcgctgcgtcatcatgctgcgaaatccggt
gacggcgatggctag

DBGET integrated database retrieval system