KEGG   Erythrobacter sp. YH-07: DVR09_08450Help
Entry
DVR09_08450       CDS       T05587                                 

Definition
(GenBank) hypothetical protein
Organism
err  Erythrobacter sp. YH-07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat
Motif
Other DBs
NCBI-ProteinID: AXK42363
UniProt: A0A345YEL1
LinkDB All DBs
Position
1723555..1725522
Genome map
AA seq 655 aa AA seqDB search
MRIFWGFALGIGCIATAAVGQTTAGEELNKEFIPNEDMMMSAGGVDVLSGKYQPSGPDLA
FGSDFGFSRQAPPGIPGHFNSMGVFGHNFDIMITERKFDHTKANPNVSGDDYRMGVRFGP
LSASFDSLSYESGFTPTGQGREGKLVVSGNRASSTAKYTYTSRNGTVATFRSIGLGDCST
EYRCAYVDHVKYPDGTVLKFSYVNVGGSYNPTVLKSVVSSIGNAFVFDYGNVGGKNVIAK
ACAVNLAVDPLPANCRQETVNVAVYTYSAIGGTPHMTSATRPGNEEEVYTYSSNGLTQTY
KRTGEATPWQTIQFALRQNVELINERVVTSQTFSTGESLLYTSTPAPVFVPGQPLPRGNL
VITDSLGGETQYLYDFPVNALAEKLSGSPTPGIPPDFDFNNYRQVEGGPSRIVDELGRTT
HYNYCDRLAAQYDVNGDGVSDCQVGYLQDFTLPSGHKTELYYVGPGKVGEYRQIDSTGQL
PTRSLVQEFACTVPVCEQKPTKRQDPNGSTTDYVYSTNHGSVIVETQSADAGGVRPQRRY
TFAKKYAWIKSGTGFVSNTDGKWVPIKEEYCQTSASANLNVSANSASADCAAGPADEVIT
TYEYQEGSASRGSNVLLVGKAVTADGQSLRTCYGYDAMGRKISETGPRAGLASCQ
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagaattttttggggttttgctttgggaattggctgcatcgcgacagccgccgtaggt
caaacaacggctggcgaagagttgaataaagagttcattcccaatgaagacatgatgatg
tccgccggtggggtggacgtgttgtccggcaaatatcagccttcgggtccggatctagcg
tttggttctgactttggcttctcgcgacaggcgccgcctggaattcccggtcacttcaat
tccatgggcgttttcgggcataatttcgacatcatgatcacggagcgaaagttcgaccat
accaaggcgaaccccaatgtttctggggatgattatcgaatgggggtgcgatttggcccg
ctgtcagcgagcttcgactccctgtcgtacgaaagtgggtttacgccgactggccagggc
cgtgaagggaagttggtagtctctggaaatcgagcaagttcgaccgccaaatacacctac
acttcgcgcaacggaaccgtggcaacatttcgctccatcgggctgggagactgttcgacc
gaatatcgatgtgcctatgttgatcacgtgaaataccctgacggtaccgtcttgaaattc
agctatgtaaacgtcggcgggagttacaatccgacggtattgaaaagtgtagtctccagc
atcggcaatgccttcgtttttgactacggcaatgttggcggcaaaaatgtgattgccaaa
gcgtgcgcggtcaacctcgccgtagatcctcttccggccaattgtcggcaggaaacggtg
aacgttgctgtctatacctattccgccattggcgggacgcctcacatgacctcggcgacg
cgtcccggcaatgaagaggaagtctatacatacagtagcaacggactcacccagacatac
aaacgcacgggcgaagctactccttggcaaaccattcagttcgccctcaggcaaaatgtc
gagttgataaacgagcgtgtggtcacctcccagacattctcaaccggtgaaagcctcttg
tatacctccacgcccgcccctgttttcgtacccggtcagcctctacctcgcggcaatctg
gtgataacggattcgctgggcggcgagacccagtatctctacgatttcccagtcaacgcg
ttggcggagaagctcagcggctcgccaacgccggggattccgccggatttcgatttcaat
aactatcgccaggttgagggcggcccttccaggatcgtcgacgaactaggtaggacgacc
cattacaactactgcgaccgcttggcagcgcaatatgatgttaatggcgatggagtcagc
gactgccaagtgggctatctgcaggattttaccctaccctccggacacaagacagagctc
tactacgtcggtcccgggaaggttggagaatatcgtcagatcgactccacgggccagctc
ccgacgcgttcgcttgtccaagagtttgcgtgcacggtgcccgtctgcgagcaaaagcct
actaagaggcaggaccccaacggtagtacgaccgattacgtctacagcacgaaccacggt
tcagtgatcgtagagactcagtcggccgacgctggaggagttcgcccccagcggcgctat
accttcgccaaaaagtatgcatggatcaaaagcggaaccgggtttgtttccaatacagac
ggtaaatgggtgcctattaaggaagagtattgccagacaagcgcatctgcgaatttaaat
gttagtgccaacagcgcgtccgccgattgcgctgcaggccctgccgatgaagtcataacg
acatacgagtatcaggagggcagtgcgtcacgtgggagcaatgtccttcttgtcggcaag
gcagtgactgccgatgggcagtcactgcgcacgtgctacggatacgacgcgatgggccgc
aagatcagtgagactgggccgagggctggtctggcgagctgtcagtga

DBGET integrated database retrieval system