KEGG   Erysipelothrix rhusiopathiae SY1027: K210_03110Help
Entry
K210_03110        CDS       T02688                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Brite
KEGG Orthology (KO) [BR:ers00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ers01001]
    K210_03110
Enzymes [BR:ers01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     K210_03110
Protein kinases [BR:ers01001]
 Serine/threonine kinases: Other
  Bacterial family
   K210_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase YrbL-PhoP_reg Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: AGN24245
LinkDB All DBs
Position
complement(591489..593240)
Genome map
AA seq 583 aa AA seqDB search
MNSIIGERYRIVKKIGTGGMADVYLALDTVLNREVALKVLRGDLSHDPVALLRFQREANA
ASGLNHQSIVEVYDVGEDEGQHYIVMEMIRGTTLKQLVHRRGALDKYESVAIMQQLASAL
QHAHAAHVIHRDIKPQNILVKDDGTVKITDFGIALAGDAIQLTKSDSVLGSVHYMAPECS
RGEGAGEQSDVYSLGVVFYELLTGDVPYRGETPVEIAMKHMREPFPSVMKFNPTLPNSIA
NIIARATHKNRTHRYANMKEFVEDLDTCLLESRADEPLWEATMESDDGTKLIEKLNGVTE
TLPNQSKPKKKRKMIVGASLLALVIIIFSIWMIFAPKKPSDIEIPDLAGLSVSEAKEHLA
NLGLNYAPSYLYEISDKYEDGKLIGTKPEKGTKVLKGDQIKLIVSQGKIYTVEDFTGKSV
NDVKAILSDKNINIKTTSEYSSSVPTGHTIRQEGLMPGDKIKPEQRYDIVLVVSSDKELV
LPGDLIGKSIADAKAQLEGLGVEVTTSELPTQNLSISELNSLSYGTVIRSNPMPGSYYIQ
NSGNSVTLYYYSESSRPKEEADEKEEKPSEPEEKPDGSNDREA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtattattggagaacgttatcgaattgttaagaagattggtaccggagggatg
gcggatgtctacttagcattggatactgttttaaatcgcgaggtagcccttaaagtttta
agaggtgatttatcccatgatccggttgcactgttgagatttcaacgtgaagccaacgca
gcttcaggattaaaccaccaaagtattgttgaggtgtatgatgtaggtgaagatgagggt
cagcactacattgtaatggagatgattcgtggtacgactttgaaacaacttgttcatcgt
cgtggtgcattggataaatatgaatcagtcgcaattatgcagcaacttgcctcggcattg
cagcatgctcatgcagctcatgttattcatcgagatattaaacctcaaaatattcttgtt
aaagatgatggtaccgttaagataactgattttggtattgcgcttgcaggtgatgcaata
caattaacgaaatcagactcagtacttggatctgtacattatatggcgccggagtgctct
cgaggggaaggtgccggggaacaatcggatgtttattcactgggagttgtattttacgaa
ttgttgaccggtgatgtgccatatcgtggtgagacacccgttgagattgcaatgaagcac
atgagagaaccatttccttcagtgatgaaatttaatccaacactgccaaattcaattgca
aatatcattgcacgggcaacacataaaaatagaacgcatcgatatgcaaatatgaaggaa
tttgtagaagatttagacacatgtcttttggagtcacgtgctgatgagcccttgtgggaa
gcaacgatggaaagtgatgacggaactaaattaatcgaaaagttaaatggtgtaactgaa
acacttccaaatcaatcaaaacccaaaaagaaaagaaagatgattgttggtgcaagctta
ctggcactggtcatcatcatcttcagtatttggatgatatttgctcctaaaaaacctagt
gatatcgaaattccagatttagcaggtctttctgtttcagaggctaaggaacaccttgca
aatttaggactcaattacgctccgtcctatttatacgaaatctctgataaatatgaagac
ggtaagttaattgggacgaaaccagagaagggtacgaaggtacttaaaggtgatcaaatt
aaactgattgtttctcagggtaaaatttacactgtagaggattttacagggaaatcggtt
aatgatgtgaaagcgattttatcggataaaaatattaatattaaaactacttcggagtac
tcatcatccgtaccgacgggtcatactattcgtcaagaaggcttgatgccaggtgataaa
atcaaaccagaacaacgttatgatatcgttttagtcgtaagttcagataaagaacttgtt
ttaccaggggatttaattggtaaatcaattgcggatgctaaagcacaattagaaggtctg
ggtgtagaggtaacaacttcagaacttccaacccaaaatctaagcatttcagagttgaat
agtttaagttatggtactgtaattcggtcaaatccgatgccaggaagctattatatccaa
aattccgggaattctgtgacgctttattactatagtgagagcagtcgtccaaaagaagaa
gcggatgaaaaagaagaaaaaccatctgaacccgaagaaaaaccagatggtagtaacgat
agggaggcataa

DBGET integrated database retrieval system