KEGG   Erysipelothrix rhusiopathiae SY1027: K210_08305Help
Entry
K210_08305        CDS       T02688                                 

Definition
(GenBank) glycoside hydrolase
Organism
ers  Erysipelothrix rhusiopathiae SY1027
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_16 CBM_4_9 Gram_pos_anchor DUF3489
Motif
Other DBs
NCBI-ProteinID: AGN25227
LinkDB All DBs
Position
1557691..1559790
Genome map
AA seq 699 aa AA seqDB search
MRKGLKNIVTVFMVLALSMTSISALELDAKNVIQDGDFEQGGSSWTQRNKGEVQDKVSYD
GKYAGVVPNTAISGNFANGFIGQVIRLEPNTTYHVSAYAKVDVKGADAIFTARFWNGQQG
DVIKGENGQTVDQLVSSTDWQKVSYTFNSGSEQGALIQLVKWSEKEETKQSNAYIDNVVV
TKESNVSEEKDDDVFTEVWRDDFDQESLNMEDWGYELGSIRGIEQQHYVNNPENVFLRDG
KLVLRATNRDAADQYLHPRDTSRNVIYNSGSIRTHGQREFLYGKLEIRAKLPKGRGAFPA
FWTLGADFTLDGKIKSEQGRGWPSTGEIDIMELIGEDRDGSHGNRTVYQTVHYGPAEDNV
GRFSGNGTAYTIPQGNFNDEFHTFALNWTEDALEWYVDDQKVRTVPYGQDPMAKDIFNKP
QYIQLNLAMGGAWPGPVGENLAGTEFVIDSVSYQQTAAQAKAAQAYYDNAPKLVGVKPLT
IMQGGTINPLEGINTIEGYDLDFSIEDTPMFNPRGGNSNVKLLVKGLDEMDLISNLPVGT
YNLHYSATPKGVDLTQDIKTPVARQATKLVVSKQAFPQSFELEITEGNTLSTLTLPQGWT
WKNPELVVKEAGMFTVLYGVKNDEHSVHVSLREIPEVPKEENKPAEVLGEKKEKDVTSTE
TTLPNTGQYTSSFAIVVALSLTCIGYVMLKLNKESKENE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaggtttaaaaaatatcgttacagtatttatggttttagctttatcaatgacg
tcaatctcagcacttgagcttgatgctaagaatgtaattcaagatggtgattttgaacaa
ggtgggtcctcatggactcaacgtaataaaggtgaagttcaggataaggtgtcttacgat
ggaaagtatgctggtgttgtaccgaatacagcaatctcaggtaactttgcaaacgggttt
attggtcaagttattcgacttgaaccgaatacaacgtatcacgtaagtgcttatgcgaaa
gtagatgttaaaggggcggacgccatctttacagcacgcttttggaatggacaacaaggc
gatgttattaaaggagaaaacggtcaaaccgttgatcaacttgtatcatccactgattgg
caaaaagtaagttatacctttaattcagggtccgaacaaggtgcgttaattcaacttgtt
aagtggtctgaaaaagaagaaacaaagcaatccaatgcttatattgataacgttgtggta
acgaaagaatcaaatgtttcagaagagaaagatgatgacgtctttacagaagtatggcgt
gatgattttgatcaagaatccctaaatatggaagattggggttatgaattgggttcgatt
cgtggtattgaacaacaacattatgtaaacaatccagaaaatgtattcttacgtgatgga
aaacttgtattacgagcaacaaatcgtgatgctgcggatcaatatttacatccacgtgac
acttcccgtaatgttatttataactcaggaagtattcgtacacatggtcaacgagaattt
ttatacggtaaattggaaattcgtgcaaagcttccgaaaggaagaggcgctttccctgca
ttttggactctaggtgctgactttacgcttgatggtaagattaagtcagagcaaggacgt
ggatggccaagtactggtgaaattgatattatggaattaattggtgaagatcgtgatggt
tcacatggtaaccgtactgtttatcaaacggttcattatggtcctgctgaggataatgta
ggacgtttttctggaaatggaactgcgtatacgattcctcaaggaaactttaatgatgaa
tttcatacttttgcactaaattggaccgaagatgctcttgaatggtatgttgatgatcaa
aaagtccgtacggtaccgtatggacaagatccaatggctaaagatattttcaataagcct
caatacattcaacttaatttagcgatgggtggggcatggcctggacctgttggggaaaat
cttgccggtactgaatttgtgattgattcagtatcgtatcaacaaactgctgcgcaagcg
aaagctgctcaggcttattatgataatgcaccaaaattagtaggggttaaacctctaaca
atcatgcaaggtggaacaatcaatccgcttgaaggtattaatacaattgaaggttatgat
ttagatttctcaatagaagatacaccgatgtttaatccacgtggtggtaattcaaatgtg
aaacttcttgtaaagggtttggatgagatggatcttatttcaaatcttccagtaggaacg
tataatcttcactatagtgcaacgccaaagggtgttgatttgacacaggatattaaaaca
ccggttgcacgtcaagcaacaaaacttgttgtttcaaagcaagcctttcctcaatcgttt
gaacttgaaataacagaaggtaatacgctatcgacacttactttaccacaaggatggaca
tggaagaatccagaacttgttgtgaaggaagctggaatgtttaccgttctctatggtgtc
aaaaatgacgaacattccgtgcatgtatcacttcgagaaattccagaagtacctaaagaa
gagaacaagcctgcggaagttcttggtgagaaaaaagaaaaggacgttacatcgactgaa
acgactctaccgaatacgggtcaatatacatcaagtttcgcaattgtggttgcgttatca
ctgacatgtatcggttatgtgatgttgaagttgaataaagaatcaaaagaaaatgaatag

DBGET integrated database retrieval system