KEGG   Eubacterium rectale DSM 17629: EUR_27850Help
Entry
EUR_27850         CDS       T02587                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ert  Eubacterium rectale DSM 17629
Brite
KEGG Orthology (KO) [BR:ert00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ert01001]
    EUR_27850
Enzymes [BR:ert01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EUR_27850
Protein kinases [BR:ert01001]
 Serine/threonine kinases: Other
  Bacterial family
   EUR_27850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like Kdo APH DUF4834 ECSCR RIO1 Nucleoside_tran OAD_gamma CD20 Pkinase_fungal SID-1_RNA_chan DUF3394 Haspin_kinase Pilin_N
Motif
Other DBs
NCBI-ProteinID: CBK91740
UniProt: D6DYS7
LinkDB All DBs
Position
2902356..2904506
Genome map
AA seq 716 aa AA seqDB search
MLEIGSFLSDRYEILSKVGAGGMSDVYKAKDHILSRFVAIKVLKQEFSEDSSFVTKFRAE
AQSAAGLEHPNIVNIYDVGSENGLYYIVMEYVEGITLKTYIEKKGQLSFKESASIAIQVA
RGIEAAHNKNIIHRDIKPQNIIISTDGKVKVTDFGIAKATSSNTISSDVMGSVHYASPEQ
ARNGFVDGRSDIYSLGIVMFEMVTGRVPFDGDTTVAVALQHLQEEIARPSIYAPDLPISF
EKIILKCTQKTPDRRYQTIEELLTDIRRSLAHPDEDFVTIAPLVDGGKTKVISPEELDKI
KEGRGVAEDLNDDDTDADNGDEYADDEDDDDEYDESLLDDDDDEEDEDDDDDGKLLNPKM
DKAITIMGIVTAVIIVIVIIYLALSVAGVFKFGGKKNSESQQTESQTQTESESESETQTE
TEGQMIDIRGMSVEDAQKAVDRLKLDLTVFAFETKQSDEKDGTILEQDVKAGDTVKRGSQ
INVVIAGKGDNTSEMVKIPSVIGKTKSSAKSTLESAGFSVTFEYGDYNDSVAADVVTAQS
PSAKKQAAKGSTVTVTLSPGQKPITVPNVVGASQSHAESALAGAGLKYTYADSQYSDTVP
AGSVISQTKSGETVAAGTTITLTLSKGKQEISTNVSKGISYSGEGTVVKAEYKLVGKSGT
VYDKGSYENTSSFTVSGTMKEATGSIVVTWTVQTGETDEAGNPATVTLDPVTYSVP
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgttagagataggaagttttttatcggatcgatatgagatcctaagcaaggttggcgca
ggcggcatgtctgatgtatacaaggcaaaagaccatatactgagccgttttgtagctata
aaggttttaaagcaggagttttcggaggatagttcatttgtgaccaagttccgtgctgag
gcacagtcagcagcaggacttgagcatccaaatatcgtaaatatctatgatgtaggcagc
gagaatggtctgtactacattgtcatggagtatgtcgagggtatcacacttaagacttat
atcgagaaaaagggccagctgtcattcaaggagtctgcaagtattgcaatccaggtggca
aggggcatagaggccgctcacaataaaaatatcatccaccgtgatatcaagccgcagaat
atcattatttctacagatggcaaggtaaaggtgacagactttggaattgcaaaggctaca
tcttcaaatacaataagctcagatgtgatgggctcagtacactatgcatctccggagcag
gcaagaaacggcttcgtcgatggcagaagtgatatttactcactgggaatcgtaatgttt
gagatggttacaggccgtgtgccgtttgacggtgataccacagtggcagttgcactgcag
cacctacaggaggagattgcaaggccaagcatctacgcaccggatctgccaatcagcttt
gagaaaatcatcttaaagtgtacacaaaagacaccggaccgcagataccagactattgag
gagcttctcacagacataaggcgctctcttgcgcatcctgatgaggatttcgtcacaata
gcaccactcgttgacggtggcaagaccaaggttataagcccggaggagcttgacaagata
aaagaaggcagaggtgttgcagaggacttaaacgatgatgataccgatgcagataatggt
gatgagtatgctgacgatgaagacgatgatgatgaatatgatgagtcactcttagacgac
gatgatgacgaagaagacgaagacgatgatgatgacggcaagcttttaaatccaaagatg
gataaagcaatcacaatcatgggtatagtaacagccgtaatcattgtaatagttatcata
tatcttgcactttcagtggcaggagtgtttaagtttggcggcaaaaagaactcagagtca
cagcagacagagtcacagacacagaccgagtctgaatcagagtcagagacacagactgag
acagagggccagatgattgacatcagaggcatgtcagtggaggatgctcagaaggcagta
gaccgcttaaagcttgacctcacagtatttgcatttgagacaaagcagtcagatgaaaag
gatggcacaatccttgagcaggatgtcaaggccggagatacagtaaagcgtggttcacag
attaatgtagttatcgcaggaaaaggtgataatacatcagagatggtcaagataccaagt
gtaatcggaaagaccaagagctcggcaaagagcacactcgagtcagcaggctttagtgtc
accttcgagtatggagattacaatgacagtgtagcagcagatgtagtaacagcacagtca
ccatcagcaaagaaacaggccgcaaagggcagcacagtaacagtcaccctctcaccgggc
cagaagccaatcaccgtgccaaacgtagtaggtgcctcacagtcacatgcagaaagcgcc
ctcgcaggagcagggctcaagtacacctatgccgactcccagtacagcgacacagtaccc
gccggcagcgtaatcagccagaccaaatccggtgaaaccgtagccgcaggcaccacaatc
acactgacactcagtaagggtaagcaggagatatcgactaacgtaagtaaaggaattagt
tatagtggagagggaactgtagtaaaagcagagtataagcttgtaggtaaaagtggaact
gtatacgataagggttcatatgaaaatacgtcatcatttacagtttccggaacaatgaaa
gaagctacaggaagtattgtggttacttggacagttcagacaggggaaacagatgaagca
ggaaatcctgcaactgtcacacttgatccagtaacgtatagcgtgccataa

DBGET integrated database retrieval system