KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum0620
Entry
Erum0620          CDS       T00224                                 

Gene name
tyrS
Definition
(GenBank) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:eru00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Erum0620 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eru01007]
    Erum0620 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eru03016]
    Erum0620 (tyrS)
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum0620 (tyrS)
Enzymes [BR:eru01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     Erum0620 (tyrS)
Amino acid related enzymes [BR:eru01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Erum0620 (tyrS)
Transfer RNA biogenesis [BR:eru03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Erum0620 (tyrS)
 Prokaryotic type
    Erum0620 (tyrS)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum0620 (tyrS)
SSDB
Motif
Pfam: tRNA-synt_1b S4 LisH
Other DBs
NCBI-ProteinID: CAH57773
UniProt: Q5HCB5
LinkDB
Position
89895..91151
AA seq 418 aa
MKLKSDFLGLLYSRGYFNQCTDLAELDQLMSKECVIAYIGFDCTARSLHIGSLMQIMILR
YLQKCGHKPIVLLGNGTTKIGDPSGKDKSRTLLSSSDIQENTLGIRKVLEKFIVCGGGVS
DALLVYNAEWLDKLNYIDFLRNIGRHFSVNNMLTFDSVKLRLEREQNLSFLEFNYMLLQA
YDFIELNQRYNCLLQIGGSDQWGNIVNGVELGRKLKLPQLFGLTTHLLLTSTGEKMGKTA
DGAIWLDGEMYSPADYWQYFRNVKDEDVGRFLRLFTELPLTEIEKLENLKGYEINEAKKI
LATEATRICHGEKIAQDIAYDALKVFECNDHSGLPVFYVCKSEIELGLSVVKLLQVSGME
KSNSSAKRLINDKGCKINDIIILDVNYKLSLQDFCGMSYIKLSCGKKRHLKVVLESDL
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaagttaaaatctgattttttaggtttattgtattcccgtggttactttaatcaatgt
actgatttagctgaactagatcagttaatgagtaaagaatgtgttattgcgtacatagga
tttgattgtactgctaggagtttgcatattggtagtttaatgcaaattatgatcctaaga
tatttacagaagtgtggtcataagccaatagtgttattggggaatggtacgacaaaaata
ggtgatccttcaggaaaggataagtctagaactctgttgtctagtagtgatattcaggaa
aatacattaggcatacgtaaagtattagaaaaatttattgtttgtggtggtggggttagt
gatgcattgctggtctataatgcagaatggttagataaattgaattatatagactttttg
agaaacataggtagacatttttctgtaaataatatgttaacttttgatagtgtaaaactg
cgcttagaaagagaacaaaatctcagcttcctagaatttaattatatgttactacaagca
tatgattttatagagcttaatcaacgttataattgtttattgcaaataggaggatctgat
cagtggggaaatattgttaatggtgtagaattaggaagaaagttaaaattaccacagctt
tttggattgactactcatttattgcttacaagtactggtgagaagatgggtaaaactgct
gatggagcaatatggcttgatggggaaatgtatagtcctgctgattattggcagtatttt
cgtaatgtgaaagatgaagatgtagggcgttttttgagattatttacggagttacctctt
actgaaatagaaaaattagaaaatttgaaaggttatgaaattaatgaggcgaagaagatc
ctagctactgaagctactagaatatgtcatggagaaaaaattgcacaggatattgcttat
gatgcacttaaagtgtttgagtgtaatgatcattctggattgccggtgttttatgtatgt
aagtctgaaatagagttaggtttgtctgtggtaaaattactgcaggtttctggtatggaa
aaaagtaatagtagtgctaaaagattgattaatgataaagggtgtaaaataaatgatata
ataatattggatgtaaattataaattatcgttacaagatttttgtggcatgtcctatatt
aagctcagttgcggaaagaagcgtcatttaaaagtagttttagaaagtgatctttaa

DBGET integrated database retrieval system