KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum1320
Entry
Erum1320          CDS       T00224                                 

Gene name
rpsP
Definition
(GenBank) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Erum1320 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eru03011]
    Erum1320 (rpsP)
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum1320 (rpsP)
Ribosome [BR:eru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Erum1320 (rpsP)
  Bacteria
    Erum1320 (rpsP)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum1320 (rpsP)
SSDB
Motif
Pfam: Ribosomal_S16
Other DBs
NCBI-ProteinID: CAH57848
UniProt: Q5HC44
LinkDB
Position
complement(234110..234373)
AA seq 87 aa
MSVKIRLARFGAKKRPFYRVVVADSRVARDGRFIELLGFYNPMLPKEHPSFLKVKVDRLK
YWLSVGAQPTERISWFIKKGLISTEAA
NT seq 264 nt   +upstreamnt  +downstreamnt
atgtctgtaaagataagactagcaagatttggagctaagaagcgccccttttatagggta
gttgttgctgattctagggtagcaagagatggcaggtttattgagctattaggtttttat
aacccaatgcttcctaaagagcatccatcattcttaaaagtaaaagttgataggttaaaa
tattggctcagtgtaggagcacaaccaactgaaagaatttcttggtttatcaaaaagggt
cttatcagtactgaagctgcgtga

DBGET integrated database retrieval system