KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum3670
Entry
Erum3670          CDS       T00224                                 

Gene name
gatA
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00970  Aminoacyl-tRNA biosynthesis
eru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eru00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Erum3670 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum3670 (gatA)
Enzymes [BR:eru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Erum3670 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Erum3670 (gatA)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum3670 (gatA)
SSDB
Motif
Pfam: Amidase
Other DBs
NCBI-ProteinID: CAH58088
UniProt: Q5HBG3
LinkDB
Position
complement(640876..642339)
AA seq 487 aa
MKDILKLSIAEMHENLIKKEFSAVELTQTHIDAINNEQLNAFITKTPEVALDAARKADHI
LIHEQDKITPLTGIPVGIKDLFCTKNIKTTACSNILRNFTPQYDSTVVKRLIDDGAVMLG
KLNMDEFAMGSSNSNSCFGPVENPWTRADGVKVVPGGSSGGSSAAVAGFLCAGALGSDTG
GSVRQPAAFCGIVGLKPTYGRCSRLGMIAFASSLDQAGVLTRTVKDAALMLQPICGYDTQ
DSTSANITTPRFLDSITNIIKGKRIGIPKEYELSDKYKEYEEVSEMWLKGIKYLENEGAE
IVNISLPHTSYALPVYYIICSAEASSNLARYDGIKYGTRVNSDNINEMYELTRGNNLGTE
VKRRILIGAYALSSGYYDAYYNKAQCIRRLVTNDFVESFKSVDYILTPTAPKEAFAMDEQ
LDTLTMYLNDVFTVPASLAGLPAISIPIGLSKNKLPLSLQIIGNYYDEGGILNIASVIEK
HTGNILK
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgaaagatattttaaaattatccattgcagaaatgcatgaaaatctaataaaaaaagag
ttctcggctgtagaactcacccaaactcatattgatgctataaataatgaacagttaaat
gcttttattacaaaaacaccagaagttgcattagatgctgcaagaaaagcagatcacatt
ttaatacatgaacaagataaaatcaccccattaactggaattccagttggaataaaagac
ttattctgtacaaaaaatattaaaacaacagcatgttctaatatactaaggaattttact
ccacaatatgactcaactgtagtaaagcgacttattgatgatggtgctgtaatgctagga
aagctaaatatggatgaatttgctatgggttcatcaaattctaatagctgctttggtccg
gtagaaaatccctggacaagagcagatggagtaaaagtagtacctggaggatcatcaggt
ggatcaagtgctgctgtagcaggttttctatgtgctggcgctttaggaagtgatacaggt
ggatcagtacgtcaacctgcagcattctgtggaatagtaggattgaaaccaacatatgga
aggtgttctagattaggaatgatagcatttgcaagttctcttgatcaagcaggagtacta
acacgcacagtaaaagatgcagctctaatgctacaaccaatttgtggatatgatactcaa
gattccacttctgctaacataaccacacccagattcctagatagtattacaaacatcata
aaaggtaaacgaattggaattcctaaagaatatgagttatcagataagtataaagaatac
gaagaagtttcagagatgtggttaaagggaattaagtacctagaaaatgaaggggctgaa
attgtaaatattagtttgccacacacaagttatgcactccctgtatattacattatttgc
tctgcagaagcatcatctaatcttgcaagatatgatgggataaaatacggaacacgtgta
aactctgataacataaatgaaatgtatgagttaacacgaggaaataatcttggaacagaa
gtaaaaagaagaatattaataggagcatacgcattgtcatctggatattacgatgcatat
tataacaaagcgcaatgtattagacgtttagtaacaaatgactttgtcgaatcctttaag
agtgttgattacattcttacccctactgctcctaaagaagcattcgcaatggatgaacaa
ttagatacattaactatgtatttaaatgacgtatttactgttccagcaagtctagctgga
ttgccagctatttctataccaataggattatcaaaaaacaagttacctctttctttacag
ataataggtaactattatgatgaaggaggtattttaaatatagcaagtgtcatagaaaaa
cacacaggaaatattttaaaataa

DBGET integrated database retrieval system