KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum5420
Entry
Erum5420          CDS       T00224                                 

Gene name
probable_era
Definition
(GenBank) putative GTP-binding protein ERA
  KO
K03595  GTPase
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Brite
KEGG Orthology (KO) [BR:eru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eru03009]
    Erum5420 (probable_era)
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum5420 (probable_era)
Ribosome biogenesis [BR:eru03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   Erum5420 (probable_era)
 Prokaryotic type
  GTPases
   Erum5420 (probable_era)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum5420 (probable_era)
SSDB
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU RsgA_GTPase AIG1 Dynamin_N cobW PduV-EutP Arf Ras MMR_HSR1_Xtn Roc ABC_tran SRPRB GBP IL2 AAA_29 AAA_22 FtsK_SpoIIIE
Other DBs
NCBI-ProteinID: CAH58271
UniProt: Q5HAY9
LinkDB
Position
complement(935639..936529)
AA seq 296 aa
MNHVGRKCSMSAIVGATNAGKSTLVNVLVGQKVAAVTPKVQTTRVRMHAVSNHENVQLIF
IDTPGIFSPKTKLEKFLVKHAWMSLKGIENVIVLVDVKNYLNQHLKKIIDRIKHSNLNAI
LVLNKIDIVHQSIVSEVIEYMYSLYKFSKAFTISALYGIGIDKLVDYLCETSPYGPWLYN
DDQISDAPLKFFMAEITREKLFITLRHELPYSLSVVTELVEEKEDNSLIIKQVIYVTKGS
HKTIILGKKGEMVKKISMESKSDLENILQVKVHLFLFVKVREFWQNHLNECVGYAE
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaatcatgtaggtagaaaatgttctatgagtgctatagttggggcaactaatgcaggt
aagtcaacattagttaatgtactagtagggcaaaaggttgcagcggttactccaaaagtg
caaactacaagagtaaggatgcatgctgtttcaaatcatgaaaatgtacagttgatattt
atagatacaccgggtatattttcaccaaagacaaaattggaaaagtttttagttaagcat
gcatggatgtctctcaagggcattgaaaatgtaatagtattagttgatgtaaaaaactat
ttaaatcagcatctgaaaaagattattgatagaataaaacattctaatcttaatgctatt
ttggttcttaacaagattgatatagttcatcaatcgatagttagtgaagtaatagaatat
atgtattctttatataaattttctaaggcttttactatttctgcattatatggaattggt
atagataaattagtagattatttgtgtgaaacttcaccttatggtccttggttatataat
gatgatcagattagtgatgcacctttgaagttttttatggctgaaattacacgtgaaaag
ttatttataactttacgtcatgaattgccgtattcgttatctgtggttactgaattggtt
gaagaaaaggaagataatagtttaattattaaacaagttatatatgtgactaagggtagt
cataagaccatcattctaggtaagaaaggtgaaatggtgaaaaaaattagtatggaatct
aaatctgatcttgaaaacatacttcaagtaaaagtacatctttttttatttgtaaaagtt
cgagagttttggcagaatcatttaaatgagtgtgtaggatatgctgagtaa

DBGET integrated database retrieval system