KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum5740
Entry
Erum5740          CDS       T00224                                 

Gene name
rpmF
Definition
(GenBank) 50S ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Erum5740 (rpmF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eru03011]
    Erum5740 (rpmF)
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum5740 (rpmF)
Ribosome [BR:eru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Erum5740 (rpmF)
  Bacteria
    Erum5740 (rpmF)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum5740 (rpmF)
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-ProteinID: CAH58304
UniProt: Q5HAV7
LinkDB
Position
complement(991865..992047)
AA seq 60 aa
MAVPKRKKSKSRRNMHRSHCKLKVPNIGIDKTTGEYKLSHHICLGGYYNGKQIVEVDSNI
NT seq 183 nt   +upstreamnt  +downstreamnt
atggctgtaccaaaaagaaaaaagtcaaagtcacgtcgtaatatgcaccgttcacattgt
aaattgaaagttcctaatattggaattgataaaacaactggagaatataagttatctcat
catatatgtttaggtgggtactataatggtaagcaaatagtggaagttgatagtaatata
taa

DBGET integrated database retrieval system