KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6870
Entry
Erum6870          CDS       T00224                                 

Gene name
rpsF
Definition
(GenBank) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru03010  Ribosome
Brite
KEGG Orthology (KO) [BR:eru00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Erum6870 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:eru03011]
    Erum6870 (rpsF)
   03029 Mitochondrial biogenesis [BR:eru03029]
    Erum6870 (rpsF)
Ribosome [BR:eru03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    Erum6870 (rpsF)
  Bacteria
    Erum6870 (rpsF)
Mitochondrial biogenesis [BR:eru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Erum6870 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6 DUF5352
Other DBs
NCBI-ProteinID: CAH58419
UniProt: Q5HAJ4
LinkDB
Position
complement(1164456..1164785)
AA seq 109 aa
MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYAIDKMNKGHY
CMMYIRSSSTSMDEFKRKVRLNEDVLRFLCLKRDKLPEGDSLMVQASQA
NT seq 330 nt   +upstreamnt  +downstreamnt
gtgcctttatatgagtttacttttatagcgcaacaaggtttaactcaatatgagttagaa
gggttagtgaaaggtttatcgtctttattgacaaaaaatggtgctgaacttcttaagtat
gaatactggggactcttggattttgcttatgcaatagataagatgaacaaagggcattac
tgtatgatgtatatcaggtcatcttctactagtatggatgagtttaagcgtaaggtaaga
ttaaatgaagatgtcttacgcttcttatgtcttaagagagataagttaccagaaggtgac
tcgttaatggtacaagcaagtcaagcatag

DBGET integrated database retrieval system