KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_02920Help
Entry
ERWE_CDS_02920    CDS       T00233                                 

Gene name
fabI
Definition
(GenBank) Putative Enoyl-[acyl-carrier-protein] reductase [NADH]
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
erw00061  Fatty acid biosynthesis
erw00780  Biotin metabolism
erw01100  Metabolic pathways
erw01130  Biosynthesis of antibiotics
erw01212  Fatty acid metabolism
Module
erw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:erw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ERWE_CDS_02920 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ERWE_CDS_02920 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ERWE_CDS_02920 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:erw01004]
    ERWE_CDS_02920 (fabI)
Enzymes [BR:erw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     ERWE_CDS_02920 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     ERWE_CDS_02920 (fabI)
Lipid biosynthesis proteins [BR:erw01004]
 Fatty acid synthase
  Component type
   ERWE_CDS_02920 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CAI26786
UniProt: A0A0H3M814
LinkDB All DBs
Position
485332..486153
Genome map
AA seq 273 aa AA seqDB search
MTASNIMKGKRGLILGIANDKSLAWGIAKTLAMHGAEIAVTYLSDIFKKRIDPLVESIGV
KLVLQCDVSQEQSIDAMFDLLSEEWESVDFLVHAVAFSDKNELKGRYIDTSLDNFLTSMH
ISCYSLTYLTKKVEKMMCHGGSILTLSYYGAQKVMPHYNVMGVCKAALEASVKYLAVDLG
SQNIRVNAISAGPVRTLASSGIGDFHYILTWNKYNSPLRRNTTIEDVGGAALYLLSDLGK
GTTGEILYVDSGYHAIGMKAIDAPDIHYIEGNK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgactgctagtaatataatgaaagggaaaagagggttaattcttggtattgccaatgat
aagtctttagcatgggggattgctaaaactttggctatgcatggagcagagatagcagtt
acttatttgtctgatatttttaagaaaagaatagatcctttagttgagtctataggagta
aagttagttttacagtgtgatgtatcacaggaacaatctatagatgcaatgtttgatctt
ttgagtgaggaatgggaaagtgtggactttttagtgcatgctgttgctttttctgataaa
aatgaacttaaaggtaggtatattgatacatcattagataatttcttaacatctatgcat
atatcatgttattcactgacttaccttactaaaaaggttgagaaaatgatgtgtcatggt
ggtagcatattaacattatcttattacggtgctcaaaaagtaatgcctcattataatgtt
atgggagtatgtaaagcagctttagaagcaagtgtaaaatatttagcagttgatcttggt
tctcaaaatattagggtgaatgctatttctgccggtcctgttagaactctagcatcttct
ggaataggtgattttcattatatattaacatggaataagtataactcaccactgcggcgt
aatacaacaatagaagatgtgggtggtgctgcactttatttattgagtgatttaggtaaa
ggtactactggagaaattttatatgttgacagtggttaccatgctataggtatgaaagca
atagatgctcctgatattcattatattgaagggaataaatag

DBGET integrated database retrieval system