KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_08770Help
Entry
ERWE_CDS_08770    CDS       T00233                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
erw00061  Fatty acid biosynthesis
erw00780  Biotin metabolism
erw01100  Metabolic pathways
erw01212  Fatty acid metabolism
Module
erw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:erw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ERWE_CDS_08770 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ERWE_CDS_08770 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:erw01004]
    ERWE_CDS_08770 (fabZ)
Enzymes [BR:erw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ERWE_CDS_08770 (fabZ)
Lipid biosynthesis proteins [BR:erw01004]
 Fatty acid synthase
  Component type
   ERWE_CDS_08770 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT AfsA MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: CAI27371
UniProt: Q5HA53
LinkDB All DBs
Position
1399635..1400072
Genome map
AA seq 145 aa AA seqDB search
MQFNIQDIIKMLPHSYPFLLLDKVTACVPNESATAIKNVTFNEPFFIGHFPNNPVMPGVL
IVEAMAQACLVCVMSDSKCNFENYTIYFMSIELAKFRKPVIPGDILTIEVNVIHKRKDTC
RFQCFARVDQALASEAQILAMIKKN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttaatattcaagatattattaagatgttaccacattcttatccctttttattg
cttgataaagtaactgcatgtgttcctaatgagtctgcaacagcaataaaaaatgttact
tttaatgagcctttttttattggacattttcctaataaccctgttatgcctggtgtactg
attgtagaagctatggcacaagcatgtttggtctgtgtaatgagtgattctaagtgtaat
tttgaaaattatactatatattttatgtcaatagaattagcaaaatttcgtaaacctgtt
attccaggtgatattttaactattgaagtaaatgtcatacacaaaagaaaagatacttgc
agatttcaatgctttgcgcgtgtagatcaagcattagcttctgaagcacaaatcttagca
atgattaaaaaaaattag

DBGET integrated database retrieval system