KEGG   Erythrobacter sp. s21-N3: CP97_01145Help
Entry
CP97_01145        CDS       T03997                                 

Definition
(GenBank) two component transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
ery  Erythrobacter sp. s21-N3
Brite
KEGG Orthology (KO) [BR:ery00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ery02022]
    CP97_01145
Two-component system [BR:ery02022]
 OmpR family
  Unclassified
   CP97_01145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AKQ40953
UniProt: A0A0H4VV86
LinkDB All DBs
Position
227374..228111
Genome map
AA seq 245 aa AA seqDB search
MNEPQVKLLLVDDEASLREPLAEYLSRQGFAVEQAADASKARTALQDDIPDLVLLDIMMP
GEDGISLCRHLIEAQNLPVIFLTAKGEATDRIVGLEVGADDYVVKPFEPRELVARIRSVL
RRANKGAPAAPKETDAHYAFDGWKLDPLKRRLTDPEGTVVPVSSAEFRLLLAFLDHPRQV
LDRDRLLDMVQGREAHLFDRAVDNQVSRLRRKIEQDSRDPKLIQTVWGGGYRLACDVRRI
VPSVD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaaccgcaggtaaaactgctgctggtggatgatgaagccagcttgcgtgaaccc
ctggccgagtatctctcgcgccaggggtttgccgtggagcaagccgcagatgcatccaag
gcgcgcacagcgttgcaggatgacatcccggatctcgtcctgctcgacatcatgatgcct
ggggaagacgggatttcgctgtgccgccatttgatagaagcgcagaatctgccagtcata
ttcctcaccgccaagggcgaggcaaccgatcgcatcgtcggtctggaagtgggcgcggat
gattatgtcgtcaaaccctttgaaccgcgtgaacttgtagcgcgtatccgttcggtcctt
cgccgcgccaataagggcgcgcccgctgcgccgaaggaaacagacgcgcattatgcgttc
gacggctggaagcttgatccgctgaagcggcggctgactgatcctgaaggcacagtcgtg
ccagtatcttctgccgagtttcgcctgctgctggcctttctcgatcacccgcgacaggtg
ctggaccgggaccggctgctggacatggtgcaggggcgcgaagcgcatctgtttgatcgt
gcagtggacaatcaggtcagccgattgcgccgcaagatcgagcaggatagccgcgatccc
aaactgatacagaccgtttggggcggcgggtatcgtcttgcctgcgatgtgcgacgcatc
gttccttctgtcgactga

DBGET integrated database retrieval system