KEGG   Erythrobacter atlanticus: CP97_04235Help
Entry
CP97_04235        CDS       T03997                                 

Definition
(GenBank) alkyl hydroperoxide reductase, subunit f
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ery  Erythrobacter atlanticus
Brite
KEGG Orthology (KO) [BR:ery00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CP97_04235
Enzymes [BR:ery01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CP97_04235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Spermine_synth HI0933_like FAD_binding_3 K_oxygenase NAD_binding_7 Thi4 NAD_binding_8 FMO-like Glutaredoxin DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AKQ41410
UniProt: A0A0H4VAB0
LinkDB All DBs
Position
complement(863023..864609)
Genome map
AA seq 528 aa AA seqDB search
MLDQAMKDQLKAYLGNLREPIELVASLGEGAKSDETRALLETIDDLSDKVSTAFDGDDDR
RPSFVVRRASDHSRQVRFAGLPMGHEFTSLVLALLWAGGHPPKIDQALIEQARALEGDYA
FEMYFSLSCHNCPDVVQALTLLAMENPRISATLIEGGTFQDEIEARGVMAVPATFLNGES
FYNGKMGLEEVLAKLDTSAGAKAAEAQSAKAPFEVLIVGGGPGGVAAAIYTARKGIRTGI
AAERFGGQLNDTLGIENLPGTEYTEGPKLTESLGRQIAALEAIDLMNLAKAQKLVPAGEP
GGLHELHLENGAVLKARSLILSTGARWRTLGVPGEDEYRNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLANIVGHVTVVEFDTALRADKVLQDKLESLANVDVLVNAQTTSIEG
DGNRVSGTSYKDRASGEERKFALEGVFVQIGLVPNTEWLENSDLELSPHGEIVIDSQGKT
NLPGIFAAGDCTTVPYKQIVVAMGAGSKAALSAFDYLIRNNEAVPVAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcaggccatgaaagatcagctcaaagcctatctcggcaatctgcgcgagcct
atcgaacttgtcgcctcgcttggcgagggtgcgaaatcggacgaaacgcgcgctctgctg
gagacaattgacgacctttccgacaaggtttctaccgcctttgatggcgatgatgaccgt
cggcccagtttcgtcgtgcgccgtgcatcggaccattcgcggcaagtccgctttgccggt
ctgccgatggggcatgaatttacctcgctggtcctcgcgctgctatgggccggtggccac
ccgcccaaaatcgatcaggcgctgatagaacaggcacgcgcactggagggcgattatgct
ttcgagatgtatttctcgctatcgtgccacaattgcccggacgtggtgcaggcactcacc
ctgctggcgatggaaaacccgcgcatcagcgccacgctgatcgaaggcggcacattccag
gatgagattgaggcgcgcggtgtgatggccgtgcctgccaccttcctcaatggtgaaagc
ttctacaatggcaaaatgggcctggaagaagtgctggccaagctcgatacgtccgctggg
gccaaggcagccgaggcgcaatctgccaaggcaccgtttgaagtgctgattgtcggcggt
ggtcccggcggtgtggcagcggccatttacaccgcgcgcaagggcattcgcaccggtatt
gctgcagagcggttcggcggccagttgaacgatacgctggggatcgaaaaccttccgggc
actgaatataccgagggccccaagctgacagaaagccttggacggcagatcgccgcgctc
gaagcgattgacctgatgaacctcgcaaaggcgcagaaactggtccctgcgggtgagccg
ggcgggctgcatgaactccaccttgaaaacggcgccgttctgaaagcgcgctcccttatc
ctgtctaccggggcgcgctggcgcacgctgggcgttccgggagaggatgagtatcgcaac
aagggcgttgcctattgcccgcattgcgatggcccgctgttcaaggggaaacgcgtggcg
gtaatcggcggcggcaattcaggtgtcgaagcggccatcgatctcgccaatatcgtgggc
cacgtcaccgtggtggaatttgataccgccctgcgcgccgacaaggtgttgcaggacaag
ctggaaagccttgccaatgtcgatgtgctggtaaacgcgcagaccaccagcatagaaggc
gacggcaaccgcgtcagcggaacgagctataaggaccgggcaagcggagaagaacgcaaa
ttcgcgctggaaggcgtcttcgtgcaaatcggccttgtccctaataccgaatggctggaa
aacagcgatctggagctttcgccccatggcgaaatcgtgatcgacagccagggcaagacc
aatttgcccggcatctttgccgctggcgattgcaccactgtgccttacaaacagatcgtg
gtggcgatgggtgcaggttccaaggccgctctatctgccttcgattacctcatccgcaat
aacgaagctgtgcccgtcgccgcctga

DBGET integrated database retrieval system