KEGG   Erythrobacter atlanticus: CP97_04910Help
Entry
CP97_04910        CDS       T03997                                 

Definition
(GenBank) peptidase
  KO
K08484  phosphotransferase system, enzyme I, PtsP [EC:2.7.3.9]
Organism
ery  Erythrobacter atlanticus
Pathway
ery02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ery00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CP97_04910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ery02000]
    CP97_04910
Enzymes [BR:ery01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     CP97_04910
Transporters [BR:ery02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    CP97_04910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers GAF_2 GAF GAF_3 SpoVT_C Lipase_GDSL
Motif
Other DBs
NCBI-ProteinID: AKQ41503
UniProt: A0A0H4VWQ5
LinkDB All DBs
Position
997475..999745
Genome map
AA seq 756 aa AA seqDB search
MSAFSAARSILTSLHEVMAARTHAQAKLNQVVEIIGESLHSEVCSIYLLREGMLELYATR
GLNQAAVHVTRLGVGEGLTGAIAQNIETLNLDEAATHPEFQYRSETGEENFHSFAGVPIV
RRERAIGVLTIQHVDPRKYEEVEIEALQTVAMVLAELINNAGLADEEGLGGSTEARTGQE
SLDGLKLVAGLAIGEAVFHQPRIQIEQTVAEDIEAERQRVYLAFDRMREQIDTMTNQAEF
GVDGEHGQVLETYKMFAYDEGWSRRINEAIDSGLTAEAAIERVQQRTRMRMRAISDPLLR
DRMHDLEDLSNRLIRIVSGQLGTAAQKGLARDSILVAKNLGPAELLEYDKRRLKGVVLEE
GSLTAHVVILARAMGIPVVGRLRNVRGLVRDGDTILVDGDAGKVTLRPGQGVTSAFQTRF
TRSREKQASYAKLREVEPFTRDGKRINVMMNAGLRDDVAMLAMTGADGIGLYRTEFQFLV
SAALPQRERQARLYRDVLEAANGKKVVFRTVDIGGDKSLPYLSSETAKLDENPAMGWRAL
RLALERDGLMKAQARALLEGAAGYELNVMFPMVSEPWEFDAAKDVFDQQLAWLKTRKAQL
PSAIRYGVMLEVPSLAEMLDQLLPRLSFISIGTNDLTQFLFAADRANPMLAERYDWLSPS
ILRFLSRVVSNCEGEQVDLGVCGEMGGRRLEALALIGLGIRRLSITPAAVGQIKELVRKV
DTREIGDAMDGWLASPPLDMRVALQAWAKAHSIEVD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccttttctgccgcacgatccattttgacttcgcttcacgaggtcatggccgcg
cgcacgcatgcgcaggcgaagctgaaccaggtcgtcgagatcattggcgaatcgcttcat
agcgaagtgtgttcgatttacctgctgcgcgaaggcatgttggaactgtacgcaacgcgc
ggccttaaccaggcggcggttcatgtcacccggcttggtgtgggcgagggcctgacgggc
gcgatagcccagaatatcgagacgctgaaccttgacgaggcggcgacccatcctgaattt
caatatcgatccgaaacgggggaggaaaatttccactcttttgctggcgtgcctatagtc
cgtagagaacgagctattggcgttctgaccattcagcatgtcgatccccgcaaatatgaa
gaggtggagatcgaggctctacaaacggtcgcaatggtgctggccgaactgatcaacaat
gccggtctggcagatgaggaagggctgggcgggtcgacagaggcgcgaaccgggcaggaa
tcgctggatggactgaagctggttgccggacttgctattggggaggccgtgtttcaccag
ccgcgcatccagatcgagcaaaccgttgccgaagatatcgaggcagaacgccagcgcgtc
tatctcgcctttgatcgcatgcgcgagcagattgataccatgaccaaccaggccgaattt
ggcgtggatggggagcatggccaggtgctcgaaacatacaagatgttcgcctatgatgaa
ggttggtcgcggcgcattaacgaagcgatcgattccggcctgacagccgaagcggccatc
gaacgggtgcagcagcgtacgcggatgcggatgcgggcgatttccgatccattattgcgc
gatcggatgcacgatctggaagatctttcgaaccggctgatccgtatcgtgtccggccag
cttggtactgcagcgcaaaaaggtctggcgcgcgattccattctggtcgccaagaatctg
ggcccggccgaattgctcgaatatgacaagcggcggctgaaaggtgtggttctcgaagaa
ggctcgcttacggcgcatgtcgtcatcctggcgcgtgccatgggcattccggtcgtcggc
cgcctgcgcaatgtgcgtgggttggtgcgagatggggatacgatcctggtcgatggtgat
gcgggcaaggtaacgctgcgtcctggccagggcgttacctccgcctttcaaacgcgcttt
acccgcagcagggaaaagcaagcatcctatgccaagctgcgcgaggtcgaaccatttacc
cgcgatggcaagcggatcaacgtgatgatgaatgcaggcctgcgtgatgatgtcgccatg
ctggccatgacgggggccgacggtatcgggctctatcggactgaatttcagttcctcgta
tcggccgccttgccgcaacgcgaacgtcaggcgcggctttatcgcgatgtgctggaagcg
gccaatggcaagaaggtggtgtttcgcaccgtcgatattggcggcgataaatccctcccc
tatctttccagcgaaaccgccaagcttgatgaaaacccggccatgggctggcgcgcgctg
cgccttgcgcttgaacgcgatggcttgatgaaggcccaggcccgcgcattgctcgaaggc
gcggctggctacgaactcaacgtcatgttcccaatggtgtctgaaccatgggagtttgat
gcagccaaggatgtgtttgaccagcaattggcgtggctcaagacccgcaaggcgcaattg
cccagcgcgatccgctatggcgtaatgctcgaagtgccctcacttgccgagatgctggac
cagttactgccgcgcctgtcttttatctcgatcggcacgaatgatttgacgcagttcctc
ttcgccgctgaccgggcgaacccgatgctggcggaacgctatgactggctcagcccgtcg
atcctgcgttttctctcacgggtggtgagcaattgtgaaggtgagcaggtagatcttggc
gtgtgcggcgaaatgggcggccggcgactggaggcgctggcgctgatcgggctgggcatc
cgccgcctttcgattacccctgcagcggtcggccagataaaagagctggtgcgcaaggtg
gacacacgcgaaattggcgatgcgatggacggctggcttgcgtcacccccgcttgatatg
cgggttgcgttgcaagcttgggcgaaagcgcattcaatcgaagtcgattag

DBGET integrated database retrieval system