KEGG   Erythrobacter sp. s21-N3: CP97_04935Help
Entry
CP97_04935        CDS       T03997                                 

Definition
(GenBank) Putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ery  Erythrobacter sp. s21-N3
Pathway
ery00620  Pyruvate metabolism
ery00680  Methane metabolism
ery01100  Metabolic pathways
ery01120  Microbial metabolism in diverse environments
ery01200  Carbon metabolism
Module
ery_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CP97_04935
  09102 Energy metabolism
   00680 Methane metabolism
    CP97_04935
Enzymes [BR:ery01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CP97_04935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKQ41506
UniProt: A0A0H4VF89
LinkDB All DBs
Position
complement(1003622..1006393)
Genome map
AA seq 923 aa AA seqDB search
MDIAYLDERLRELHGRTTETPLFNPVFQLAHDLSRQLEAGELSLNDIENVIADLEVAALG
ERASRLSRMVQPLDDSSNEAALAESLGAGDFTAFRNRWERPCLHAVFTAHPTFLLTPDQS
EAVATAACQNAKIDKTIVGGERPQVSLSYEHERAMRAIAHAQDARDSIVSQLLSHARDNW
PDEWHDITPLPFRFASWVGYDMDGRTDITWSNSVGFRLSEKAERLQRYTASLEAIDADHP
MLAEMRAEAAYAAERAQDFAADLSDPAALSIAANRLTASDPRKLLSLSQHISKLEEEARN
CDDAARAIVLKTLAAAMRADGLGMGWIHFRVNAKQLHNAIRRRIDPEGNLDLASKGAVVH
LRRAIADVDPRRSNFGALAIEASTAIRQFLAMAQILQHVDADAPIRMLVAECEEPATVLS
ALYFAKLFGIADQVDVSPLFETESALEHGGRFLDELLAEEVYRDYARKRGRVAIQTGFSD
AGRFVGQVPASLAIERLQGRLAVAMKANGMSDVAALIFNTHGESMGRGAHPNNMADRLDW
PLSPWAKRRFARAGVALEPEVSFQGGDGYLWFATPELARATLTRIACLRPSETDKDVPKD
PFYQRTDLSLDFYRAIKDHQREHLESRTYSRAITAFGLGLLNSTGSRVSRRQSDLSADRE
MSLRQIRAIPHNAILQQLGYPVNVIAGIGHAAEGNYEEIAAMLVESPRGRELVRLVRAAN
ALASVKTVAAYGELFNSAYWASRPYRGTEKNLTTACESLSEYLVKDDRVGVFRRLASRLR
VDAMKLHRLLDFVPDEAPIEGREDKRRMIGILQALRITLFQAMFIRAVSVPVFSRANDVS
RDDVLEMVFTLRVEDALAQLRRAYPTSFPRITRFDLNEATDWPDGADEGYEAIHRDFIDP
IERAHKLSLRISTAISNIFGAHG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcatatttggatgagcgcctgcgggagctccatggccgcacgacggaaacg
cccctcttcaacccggttttccaactcgctcatgatttgtcgcgccagctggaagcgggc
gagttgtcgctcaacgatattgaaaacgtgatcgcggatctcgaagttgccgccctgggc
gaacgcgcatcgcgcctatcccgcatggtgcagccgctggatgacagcagcaatgaagca
gccttggccgaaagcctcggtgcaggcgatttcaccgcctttcgcaatcgctgggaacgc
ccctgcctgcatgctgtcttcaccgcgcacccaacatttctgcttacgccagaccaatct
gaagcggtcgcgacggcagcctgccagaatgccaaaatcgacaaaacaattgttggtggc
gaacggccacaggtcagcctttcctatgaacatgaacgcgccatgcgggccatcgcccat
gcgcaggatgcccgcgactccatcgtttcgcagctgctgtcccatgcccgcgataactgg
cccgatgaatggcacgacatcacccccctgcccttccgtttcgccagctgggtaggttat
gacatggatgggcggaccgacatcacatggtccaattctgtcggcttccggctcagcgag
aaggctgaacggctgcaacgttataccgcttcgcttgaagccatagacgcagaccacccc
atgttggcagaaatgcgtgcagaagcggcctatgctgccgagcgggcgcaggattttgcc
gccgatctgtccgatccggccgccctgtccatagcggccaacagattgaccgcgagtgat
ccgcgcaagctcctctcgctttcccagcacatctccaagcttgaagaagaagcgcgcaat
tgtgatgatgctgcgcgcgcaatcgtgctcaaaacgctggccgccgccatgcgcgctgat
ggccttggaatgggctggatccatttccgcgtgaatgccaaacagctgcacaacgccatc
cgtcgccggattgaccccgaaggcaatctcgacctcgccagcaagggtgcggtggtccat
ctgcgccgtgcaattgcggatgtcgatcctcggcgtagcaatttcggtgcactggcaatt
gaggcttcgaccgccatccgccagttcctcgcgatggcccagatactccagcatgtggac
gccgatgcgccaatccgcatgctggtggcagagtgcgaggaacccgccacggtcctttcc
gcactctattttgccaagctgttcggcattgcggatcaggtcgatgtttcaccgctgttc
gaaaccgaaagtgcgctggagcatgggggacgcttcctcgatgaattgctcgcagaggaa
gtctatcgcgattatgcccgcaaacgcggacgcgtggccatccagaccggcttttcggat
gctggccgctttgtcggacaggtgcccgccagtctcgcaatagagcggttgcagggtcgg
cttgcagtggcaatgaaggccaatggaatgtccgatgtcgccgcgctgatttttaacacg
catggtgaaagcatggggcgcggcgcgcatcccaacaatatggcggaccgactcgattgg
cctctcagtccctgggcaaagcggcgcttcgcccgcgccggtgtggcattggaacccgaa
gtcagttttcagggcggcgacggttatctgtggtttgcaacgcccgaactggcgcgcgcc
acgctgacccgtatcgcctgcctgcgcccttccgaaacggacaaggatgtgccgaaagac
ccattctatcagcgcaccgatctcagcctcgatttttatcgcgcgattaaggatcatcag
cgcgaacatctggaaagccgcacatatagccgtgccatcaccgcctttgggcttggtctg
ctgaattccaccggcagccgcgtcagccgccggcagagcgatctttccgctgatcgtgag
atgagcctccggcagatccgcgccattccgcacaatgccatcctgcagcagcttggctat
ccggtgaatgtcatcgccgggatcggccatgctgcagaaggcaattacgaagaaatcgca
gccatgctggtcgaaagtccgcgcggccgtgaattggtacgtctggtgcgcgctgccaac
gcccttgccagcgtcaagacagtggcggcctatggcgaactgtttaattccgcatattgg
gccagccgcccctatcgcggaactgaaaaaaacctgacgacggcatgtgagagcctgtca
gaatatctggtgaaggatgaccgtgtcggcgtgttccgccgccttgccagccgcctgcgt
gtggatgcaatgaagctgcaccgcctgctcgatttcgtgcccgatgaagcgccgatcgag
gggcgcgaagacaagcgccggatgatcggcatattgcaggccctgcgcatcacccttttc
caggcgatgttcatccgcgcggtcagcgtgccggtattcagccgtgccaatgatgtttcg
cgcgatgatgtgctggaaatggtgtttacactgcgggtggaagatgcgctggcccaattg
cgccgcgcctatcccaccagcttcccgcgcatcactcgctttgatctcaacgaagcgacc
gactggcccgatggcgcggacgaggggtatgaggcgatccatcgggacttcattgacccg
atcgagcgcgcccataagctgtcactgcgcatttcgaccgcgatctctaatatattcggc
gcgcatggctga

DBGET integrated database retrieval system