KEGG   Erythrobacter sp. s21-N3: CP97_12085Help
Entry
CP97_12085        CDS       T03997                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ery  Erythrobacter sp. s21-N3
Pathway
ery00473  D-Alanine metabolism
ery00550  Peptidoglycan biosynthesis
ery01100  Metabolic pathways
ery01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CP97_12085
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CP97_12085
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CP97_12085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ery01011]
    CP97_12085
Enzymes [BR:ery01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CP97_12085
Peptidoglycan biosynthesis and degradation proteins [BR:ery01011]
 Precursor biosynthesis
  Amino acid ligase
   CP97_12085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 B12-binding
Motif
Other DBs
NCBI-ProteinID: AKQ42615
UniProt: A0A0H4VE48
LinkDB All DBs
Position
complement(2471549..2472526)
Genome map
AA seq 325 aa AA seqDB search
MARLQPLHILVLMGGWANEREVSLMSGNGVADALESAGHTVTRLDMDRDVAARIAAAAPD
VVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVVAIDKELTKQALVPHGIPMPGGRV
VKSTELFKADPVARPYVLKPVNEGSSVGVAIITDEGNYGNPISAQAKGPWQDFESLLAEP
YIRGRELTTAVIDEGGKARALGVTELIIASGFYDFEHKYTEGQTTHVFPAEIPENIAALC
RRYAEDAHRTLGCRGTSRTDFRWDDERGEDGLFVLETNTQPGMTPLSLVPEQARYCDIAY
PDLCELIVEEALHHFGKLPSGSGAV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtctgcaacccctgcatatcctcgtcctgatgggcggctgggcaaatgaacgg
gaagtctcgctcatgtcaggcaatggcgtggccgatgcactggaaagcgcgggccacacg
gtcacacgactcgatatggatcgcgacgtcgcggcaaggatcgccgccgctgcgcccgat
gtcgtgttcaatgctctgcacggcgttccgggcgaagatggcacggttcagggcatgctc
gatctcatgggcgtgccatatacgcattcgggtctggcgacctcggtcgtcgccattgac
aaggaattgaccaagcaggcgcttgtcccgcacggcattcccatgcccggtggacgggtg
gtgaaaagcacagagctgttcaaggctgatcccgtcgcgcggccctatgtcctcaaaccc
gtgaatgaaggcagcagcgtgggcgttgccatcattaccgatgaaggcaattacggcaat
cccatcagtgcgcaggccaagggcccttggcaggattttgaaagcctgctggcagaacct
tatatccgtggccgcgaattgacgacggctgtcattgatgaaggcggcaaggcccgcgcg
ctgggtgtgacagaactgatcatcgcgtcaggtttttacgattttgaacataaatatacc
gaagggcagaccacgcacgtctttcccgccgagattcctgaaaacattgccgcattgtgc
cgccgctatgccgaagatgcacatcgcacactgggctgtcgcggcactagccggacagat
ttccgctgggatgacgagcgcggcgaggatggcttgttcgtgcttgaaaccaacacccag
ccgggcatgaccccgcttagcctggtgcccgaacaggcgcgctattgcgatatcgcctat
cccgatttgtgcgaactgatcgtggaagaggcgctgcatcactttggcaagctgcctagc
ggatcgggggcagtctga

DBGET integrated database retrieval system