KEGG   Erythrobacter sp. s21-N3: CP97_12420Help
Entry
CP97_12420        CDS       T03997                                 

Definition
(GenBank) glutamyl-tRNA(gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ery  Erythrobacter sp. s21-N3
Pathway
ery00970  Aminoacyl-tRNA biosynthesis
ery01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ery00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CP97_12420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ery03029]
    CP97_12420
Enzymes [BR:ery01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CP97_12420
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CP97_12420
Mitochondrial biogenesis [BR:ery03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CP97_12420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AKQ42669
UniProt: A0A0H4VIB6
LinkDB All DBs
Position
complement(2542671..2544170)
Genome map
AA seq 499 aa AA seqDB search
MSNYRIHGATGEWEIVIGLEVHAQVTSSAKLFSGASTKFGAEPNSQVSLVDAAMPGMLPV
PNRECVRQAVRTGMAIEAEIHKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGALTIEAD
EKAGIPEDKIIGIERIHIEQDAGKLMHDQHPTMSYVDLNRSGVALMEIVSRPDMTSPAEA
GAYVRKLRSILRYVGSCDGNMEEGSMRADVNVSVRKVGDPELGTRTETKNVNSVRFVMQT
IEHEAQRQVDVLEDGGTIIQETRLFDPGTGTTRSMRSKEDAHDYRYFPDPDLLPLELDDA
FLEACRASLPELPDAKRQRYEKDLGLTPYNARELTAEVETFARFETLLAETASAIGKPAA
KVATQVANWSLSVAPGVLKSLGDDGHAAHATAARQAAILKMQDAGEISGGQAKEIFEIVL
KSGREPDEIADAEGLKQVSDTGAIEAAIDTIIAANGDKVEQYKAGKDKLFGFFVGQTMKA
MQGKANPTVVNQILKDKLG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattaccgcattcacggcgcgacgggcgagtgggagatcgtaatcggtcttgaa
gtccacgcgcaggtcacctccagcgccaagcttttttccggcgcctccacgaaattcggg
gcggagcccaattcgcaggtgagccttgtcgatgcggcgatgccgggcatgttgcccgtg
cccaatcgtgaatgtgtccgccaagccgtgcgcaccggcatggcgatagaggcggaaatc
cacaaatggagccggttcgaccgcaagaattatttctacgccgatttgccccagggctat
cagatcagtcagctttatcaccccattgtgggtgaaggcgcgctgacgattgaggcggac
gaaaaggccggtattcctgaagacaagatcatcggaattgaacgcatccatattgaacag
gatgcaggcaagctgatgcatgatcagcatcccaccatgtcctatgtcgatcttaaccga
tcgggcgtggcgctgatggaaatcgtcagccgtccggatatgacttcgccagcagaagcc
ggggcctatgtccgcaagctacgcagcatactgcgttatgtaggcagttgtgacggcaat
atggaagaagggtccatgcgcgcggatgtgaatgtgtctgtgcgcaaggttggcgatccg
gaactgggaacgcggaccgaaacgaagaacgtcaattcggtgcgcttcgtgatgcagaca
attgagcatgaggcgcagcgacaggtcgatgtgctggaagatggcgggaccatcattcag
gaaacgcggttgttcgatccgggcactggcaccacacgttccatgcgcagcaaggaagac
gcgcatgattaccgctatttcccagatcccgatttgctgccgctggaactggatgatgcc
tttcttgaagcatgtcgcgccagcctccccgaattgcccgatgccaagcgccaacggtat
gagaaggatctggggctgacgccctataatgcccgcgaacttaccgcagaggtggaaaca
tttgcccgttttgaaacgctgctggcagagacggcgagcgctatcggaaaacccgcggcg
aaggtggccacgcaggtcgccaactggtcgctttcagtggcgcccggcgtgctgaaatcg
ctgggtgacgatggtcatgcagcccatgccactgccgcaaggcaggccgccatcctcaag
atgcaggatgccggtgagatttcaggcgggcaggcgaaagagattttcgagatcgttctt
aaatccggccgcgaacctgatgaaattgctgatgcagaagggcttaagcaggtcagcgac
actggcgctatcgaagctgcaatcgacacgatcattgctgccaatggcgacaaggtagag
cagtataaggcgggcaaggacaaactgttcggcttcttcgtcggccagacgatgaaggca
atgcagggcaaagccaatccgacggttgtgaatcagatattgaaggacaagctgggctag

DBGET integrated database retrieval system