KEGG   Erythrobacter sp. s21-N3: CP97_13080Help
Entry
CP97_13080        CDS       T03997                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ery  Erythrobacter sp. s21-N3
Pathway
ery03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ery00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CP97_13080
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ery03400]
    CP97_13080
Enzymes [BR:ery01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CP97_13080
DNA repair and recombination proteins [BR:ery03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CP97_13080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKQ42770
UniProt: A0A0H4VEJ1
LinkDB All DBs
Position
complement(2665914..2668439)
Genome map
AA seq 841 aa AA seqDB search
MARKKAPSDPLATYNAKRDFDKTPEPAGAKGSSKGGNLFIVQKHDATRLHWDLRLEIDGV
LKSWAVTKGPSLDPDIKRLAVRTEDHPMFYAEFEGTIPKGEYGGGTIMLWDRGSWAPIEG
KSAKDMEKGHLHFTLDGERMRGEWLLIRLKQKPGEKRENWLLRKLNDEHAGTGDALVQRA
LTSVLTGRSMAEIGADKEGSFSLQNKKDDAFLQQMEKAADHNRGKVKRRKASPKTLPKFR
KPQLATLVDDVPAGNGWMHEIKFDGYRAMVAVAGNEVRIYTRNGKDWTDKFLPLTRHLSA
LELPACLIDGEIVAHDADGNPDFSTLQKTLKRGHGAQGEGDKLAFHAFDLVELAGEDLSA
LSNIERKERLEALLSGAEPPIHVADHIIGAGEKLYRAMCVAGQEGIISKKIDAPYRSRRS
KAWVKVKCTRRQEFVIIGWKASSARGRPFASLLLAQHEGDALVYKGNVGTGFSGEDLEML
AAKMKRLERKTAPAEVDTTSSRKVTWLTPKLVAEIAFSEFTADGNVRHGSFLGLRDDKKA
SAVKPEEPAKAPAPDTGIKISSRERVIFPDSGQTKGELADYYEKIGPIMLPFLASRPVSL
VRCPQGRARKCFFQKHDSGSFGPHVHQIPIREKDGGTEDYLYIEDTPGILACVQMGSIEF
HGWGSRSSDVEAPDKMVFDLDPDEDLDFAAVKSAATDLRDRLSDLGLVSFAMLSGGKGVH
VVVPLTPGHDWDTHKDFARRFSEALSLAEPDRFTATMSKAKRKGKIFIDWLRNQRGSTAV
LPYSARARSGAPVAAPVTWNELKTIDAANIYTIDDAQKLTSRASSKTLSGWGFANQALPG
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaagaaagccccttccgatccgctcgccacatacaatgccaagcgtgatttc
gacaagacgccagagccggcgggcgcaaagggaagcagcaagggtggcaacctcttcatc
gtccagaaacacgatgcaacgcgattgcattgggaccttcggctggaaatagatggcgtg
ctgaaaagctgggcggtcaccaaggggccgtccctcgatcccgatatcaagcgccttgcc
gtgcgcaccgaagatcaccccatgttctatgccgaatttgaagggactattcccaagggc
gaatatggcggtggcacaatcatgttgtgggatcgcggaagctgggcgcccattgaaggc
aaaagtgccaaggacatggaaaagggccatctccatttcaccctggatggagaacggatg
cgcggcgaatggctgctgatccgcctgaaacagaagcccggcgaaaagcgcgaaaactgg
cttttgcggaagttgaacgatgagcacgcaggcactggagatgcgctggttcagcgcgca
ttgaccagtgtgctgacaggccgttccatggcggaaattggcgccgacaaggaaggcagt
ttcagtcttcagaacaagaaggacgatgcctttctgcagcagatggaaaaggcggcagac
cacaatcgcggcaaggtgaagaggcgaaaggccagcccgaaaacgctgcccaaatttcgt
aaaccccagcttgccacactggtggatgatgtgcccgctggcaatggctggatgcacgag
atcaagtttgacggttaccgcgcgatggtggccgtggctggcaatgaagtgcgcatatat
acccgcaacggcaaggattggactgacaaattcctcccgctcacccgccatctctctgcg
ctggaattgccggcctgccttatcgatggcgagatcgtggcgcatgacgctgatggcaat
cccgatttttctaccttgcaaaaaacactgaagcgcggccacggcgcgcagggcgagggc
gacaagctggccttccacgcttttgatctggtggaactggcaggagaagatctttccgcc
ctgtctaatattgaacgcaaggaaaggctcgaagcgcttttgagcggggcagagccgcca
attcacgtggcggatcacatcattggcgccggagagaaactttaccgggcaatgtgtgtt
gcagggcaggaaggcatcatctccaagaagatagatgccccctaccgttcccgacggagc
aaggcatgggtcaaggtcaaatgcacgcggcggcaggaattcgtgatcattggatggaag
gcgtcttcggcaagaggccgcccctttgcttcgctccttctcgcccagcatgaaggcgat
gcgcttgtttacaagggcaatgtgggaacggggttctcaggcgaggatcttgaaatgctg
gccgcaaagatgaagcgtctcgaacgcaagaccgcccctgccgaggtggacacaacatcc
agccgcaaggtgacgtggctgacgccaaaactggttgccgaaattgccttcagcgaattc
actgccgacggcaatgtgagacacggcagctttctcggcctgcgcgatgacaagaaggcc
agcgccgtcaaacccgaagaacccgcgaaggctcctgcgcctgatacaggcatcaagatt
tccagccgcgagcgggtcatcttccccgatagcggccagaccaagggtgaacttgccgat
tattacgagaagatcggcccgattatgctgcccttccttgccagccgcccagtcagcctg
gtgcggtgtccgcaggggcgcgcacgcaaatgcttttttcagaaacacgacagcggtagc
tttggtccgcatgtccaccagattccaatcagggaaaaggacggcggcacggaagactat
ctctatatcgaggacacacccggcatactcgcctgcgtgcagatgggttcgatagaattc
catggctggggtagccgaagcagcgatgtcgaagcgccagacaagatggtgttcgacctt
gaccccgatgaggaccttgatttcgcagcggtgaaatcagccgcaaccgacttgcgcgat
cgcctgtctgatctgggtcttgtgagctttgccatgctgtcaggcgggaagggggtccat
gtcgtggtgccactgacgccagggcatgattgggacacgcacaaggatttcgcccgccgc
ttttcagaggcgctgagccttgccgagcctgaccgctttaccgccacgatgagcaaggcc
aagcgcaagggcaaaatctttatcgattggctaagaaatcagcgcggcagcactgcagtc
ttgccctattctgcgcgggcacgcagcggcgccccggttgcggcccctgtcacgtggaac
gaattaaagactatcgacgcggctaatatctatactatcgacgatgcgcagaagctgacc
tcccgtgcatcgtcgaaaacgctgtcgggctggggctttgccaatcaggcgttgccgggc
ctctag

DBGET integrated database retrieval system