KEGG   Erythrobacter atlanticus: CP97_13610Help
Entry
CP97_13610        CDS       T03997                                 

Definition
(GenBank) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ery  Erythrobacter atlanticus
Pathway
ery00260  Glycine, serine and threonine metabolism
ery00630  Glyoxylate and dicarboxylate metabolism
ery00670  One carbon pool by folate
ery01100  Metabolic pathways
ery01110  Biosynthesis of secondary metabolites
ery01130  Biosynthesis of antibiotics
ery01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CP97_13610
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CP97_13610
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CP97_13610
Enzymes [BR:ery01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CP97_13610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AKQ42843
UniProt: A0A0H4W051
LinkDB All DBs
Position
2780242..2781423
Genome map
AA seq 393 aa AA seqDB search
MSGLSMSETEVPPSDEAQDTASESLPLDAWHRAHGGRMVPFAGYEMPIQYAGEHGGIIAE
HNWTRQSASLFDVSHMGQLVVSGEGATAALEALLPGDFSSLEPGNMRYSLLLDESGGIMD
DLIVTNISRDGKEEFYIVVNGACKWDDIAHMREHLPDDIVLNYMDEQSLLALQGPQAAAV
LGSLFPGVADGLSFMQSTGFEWDGVMVGVGRSGYTGEDGFEINCPSSHVVKLADMLVADD
RVHPAGLGARDSLRLEAGLPLYGHDLTTQADPVSAGLLFALTRSRRESGGWMGHGPVSKV
LADGPAQKRVGLALQGRMPAREGAGIFSGDKQVGTLTSGGFSPTLGYPIAMGYVDTPLAA
KDTALEIEVRGKRLPAIVTPLPFVPTRYHRKGA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaggattgtcgatgagtgaaaccgaagttcccccctccgatgaagcgcaggacact
gcttccgaatcgctgccgcttgacgcatggcatcgcgcccatggcgggcgcatggtgccg
tttgccggctatgaaatgccgatccaatatgccggcgagcatggcggcatcattgccgaa
cataattggacgcggcaatccgccagcctgttcgatgtcagccacatgggtcagcttgtc
gtatcgggcgaaggtgccaccgccgccctggaggcattgttgccgggcgatttttcatcg
ctggaaccgggcaatatgcgctattcgctgctgctggatgaaagtggcggcataatggat
gatctcatcgtcacaaatatcagccgtgacggaaaagaagaattctacattgtcgtgaac
ggcgcatgcaaatgggatgatatcgcccatatgcgtgaacatctgcccgatgacatcgtg
ctcaactacatggacgaacagtcccttctggccttgcaggggccgcaggctgccgccgtt
cttggctctctcttccccggtgtggctgatggattgagcttcatgcagagcactggtttt
gaatgggatggtgtcatggtgggcgtgggccgatcgggctataccggtgaagacggcttc
gagatcaactgtccctcttcccatgtcgtcaaactggccgatatgctggtggctgatgac
cgggtccacccggccggactgggcgctcgtgacagcctgcgcctggaagcgggtctgccg
ctttacgggcatgacctgacgacccaggccgatccggtcagcgccggacttttgttcgcg
ctcaccaggtcacgccgtgaaagcggggggtggatgggccacggtccggtcagcaaggtg
cttgccgatggccctgcgcaaaagcgcgtcggtctggcgctgcaagggcgcatgcccgcc
cgcgaaggtgccggaatcttctctggcgataaacaggtcggcacgcttaccagcggcggc
ttttcgcctactctcggctatccaatagctatgggatatgtcgatacgccattggccgca
aaagatactgcactcgaaattgaagtgcgcggcaagcgccttcctgcaattgtaacacca
cttcccttcgtccccacccgctatcaccgcaaaggagcctga

DBGET integrated database retrieval system