KEGG   Erythrobacter atlanticus: CP97_14075
Entry
CP97_14075        CDS       T03997                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
  KO
K10216  2-hydroxymuconate-semialdehyde hydrolase [EC:3.7.1.9]
Organism
ery  Erythrobacter atlanticus
Pathway
ery00362  Benzoate degradation
ery00622  Xylene degradation
ery00643  Styrene degradation
ery01100  Metabolic pathways
ery01120  Microbial metabolism in diverse environments
ery01220  Degradation of aromatic compounds
Module
ery_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CP97_14075
   00622 Xylene degradation
    CP97_14075
   00643 Styrene degradation
    CP97_14075
Enzymes [BR:ery01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.9  2-hydroxymuconate-6-semialdehyde hydrolase
     CP97_14075
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Peptidase_S9 Abhydrolase_5
Other DBs
NCBI-ProteinID: AKQ42917
UniProt: A0A0H4VDZ9
LinkDB
Position
2880896..2881756
AA seq 286 aa
MSKNSIIKEEKITGRGLTSHTLLAGDPSNPAILLLHGAGPGAHAASNWYHLMPDLAENFF
VIAPDLIGFGQSEIPEPWPDSVMGWIGTRVDQCFGLLEELQVKKAHVVGNSMGGALTLQM
MSEEPDTIDKVVLMGSIGAPGPRTPELIRLLSFYSDPRYSRYRQVMHSFAHDADKFEGME
QIVKDRYKIATDPEIMKTAVKMIDSMKNGIESLNMPPELLGKMPHEVLIFHGRQDRVVPL
DTSLFLIKHLKHAELYVLDRSGHWSQLERWDVMRPMMEIHFGARSF
NT seq 861 nt   +upstreamnt  +downstreamnt
ttgagcaagaatagcattatcaaagaggaaaaaatcacaggccgcggcttgacctcacat
acgctgctggctggcgatccgtccaacccagccatattgttgctgcacggtgccggtcca
ggcgcgcacgcagcatcaaactggtatcatctcatgccggacctcgcggagaatttcttc
gttatcgctcctgatttgattggctttggtcaatcggaaatccccgaaccatggcctgac
agcgtcatgggctggattggcacgcgcgtcgaccagtgttttggcctgcttgaagaactt
caggttaaaaaagcgcatgtcgtcggcaattccatggggggcgcgcttacactacagatg
atgagcgaggaacctgatacgatcgacaaggtcgtcttgatgggttcgatcggcgctccg
gggccgcgcacacctgaactgatccggttattgtccttctattcagatccacgttattcg
cgataccgccaggtaatgcacagttttgcgcatgacgctgataagtttgaaggcatggag
cagatcgtcaaggatcgttacaagatcgccaccgatcctgagatcatgaaaacagcggtc
aagatgatcgattcgatgaaaaatggcattgaatcgctcaacatgccgcctgagctcctt
ggcaagatgccccatgaggtgctgatttttcacggtcggcaggaccgtgtcgttccgctc
gacaccagcctgtttctaatcaagcacctcaagcatgcagagctgtatgtgcttgatcgt
tcaggccactggtcgcagctggaacgttgggatgtgatgcggccgatgatggaaatccac
tttggcgcgcgctcattctga

DBGET integrated database retrieval system