KEGG   Egibacter rhizosphaerae: ER308_02975Help
Entry
ER308_02975       CDS       T05860                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
erz  Egibacter rhizosphaerae
Pathway
erz00051  Fructose and mannose metabolism
erz01100  Metabolic pathways
erz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:erz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ER308_02975
Enzymes [BR:erz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ER308_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Arg_repressor_C
Motif
Other DBs
NCBI-ProteinID: QBI18627
UniProt: A0A411YBU5
LinkDB All DBs
Position
complement(638678..639340)
Genome map
AA seq 220 aa AA seqDB search
MTSRNGAGARARLVAHAQRLVPDDLAVGTSGNLSVRLGDEILITPGGMPYDGMTPADIVR
IDERGAPADPRRRPSSELPMHRLAYEVSGAGAVVHTHSSYATAVACALDELPAVHYLLAA
VGGTVPVVPYATFGSDELAHHMARGLAGRRAVLLGNHGVLTVGATLEEAYGHAVTVEWCA
ALYHRASQLGSPRILDDAEIEHVGERFRSLGYLAHQQGER
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccgaaacggtgccggtgcgcgggcgcggctggtcgcccacgcccaacggctc
gtacccgacgacctcgcggtcgggaccagcggcaatctctcggttcgcctcggcgacgag
atcctcatcacgccgggcgggatgccctacgacggcatgacgccggccgacatcgtgcgc
atcgacgagcggggcgcgccggctgaccctcggcgccgaccctcgagcgagctccccatg
caccggctcgcctacgaggtctccggcgcgggcgcggtcgtgcacacgcactcctcgtac
gccaccgcggtcgcctgcgcactcgacgagctgcccgccgtgcactacctcctcgccgcg
gtcggtggcaccgtgccggtcgtgccctacgcgacgttcggcagcgacgagctcgcccac
cacatggctcgcggcctggccggccgccgggcggtgctcctcggcaaccacggggttctg
acggtcggagccaccctcgaggaggcctacgggcacgccgtcaccgtcgagtggtgcgcc
gcgctgtaccaccgagcgagccagctgggatcaccgcggatcctcgacgatgccgagatc
gagcacgtcggcgagcggttccgctcgctcgggtacctggctcaccagcagggcgagcgc
taa

DBGET integrated database retrieval system