KEGG   Egibacter rhizosphaerae: ER308_05460Help
Entry
ER308_05460       CDS       T05860                                 

Gene name
gatA
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
erz  Egibacter rhizosphaerae
Pathway
erz00970  Aminoacyl-tRNA biosynthesis
erz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ER308_05460 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:erz03029]
    ER308_05460 (gatA)
Enzymes [BR:erz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ER308_05460 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ER308_05460 (gatA)
Mitochondrial biogenesis [BR:erz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ER308_05460 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: QBI19045
UniProt: A0A411YCZ3
LinkDB All DBs
Position
complement(1163008..1164498)
Genome map
AA seq 496 aa AA seqDB search
MASSDPTRLDAASLLAAYADGRQTAEAATRAHLARIDATDGALGAFLRVTGEDALAHAVD
IDRRREEGRPLGPLAGVPLALKDILATRGTPTTCGSRMLEGWTPPYDATVVERLRAADAI
VLGKTNMDEFAMGSSTENSAFGPTRNPWGLDLVPGGSSGGSAAAVGAFQATLGIGTDTGG
SIRQPAAFCGIVGMKPTYGLVSRYGLVAFGSSLDQVGPLARTVGDAARLYEAIAGHDPRD
ATSIHEAPPTVADRLDRGVAGLRVGVVRSFLDGDGVDAGVRARCAEAIERFEALGAEVVD
VALPHADRALPAYYLIAPSEASSNLSRFDGVRYGLRVDGPTAEEMMARTRAEGFGPEVKR
RIMIGTYALSAGYYDAYYLQAQKVRTLVQRDLATAYADCDVLVSPATPSTAFGIGDKVDD
PLAMYLNDVFAVPSNLAGTPALSLPVGHDADGLPVGLQIMAPHLGEPVLFQAAAALEADM
GFEAAPAAVDAAVAAS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggcctcgagcgacccgacccgactggacgccgcgtcgttgctggccgcgtacgcggac
ggcaggcagaccgccgaggccgcgacgcgcgcgcacctcgcccggatcgatgccaccgac
ggcgcgctcggagcgttcctgcgggtgacgggtgaggacgcactcgcgcacgccgtggac
atcgaccggcgacgcgaggagggccgaccgctcggcccgctggcgggcgttccgctcgcg
ctcaaggacatactggccacgcgcgggaccccgacgacctgcgggtcgcggatgctcgag
ggctggacgccgccgtacgacgcgaccgtcgtggagcggttgcgcgccgcggacgcgatc
gtgctcggcaagacgaacatggacgagttcgcgatgggctcgtccacggagaactccgcc
ttcgggcccacgcgcaatccctggggtctcgatctggtcccgggggggtcctcgggcgga
agcgccgcggccgtgggggccttccaggccaccctcgggatcggaaccgacaccgggggc
tccatccggcagcccgccgccttctgcgggatcgtggggatgaagccgacgtacggcctc
gtctcccgctacggattggtcgcgttcggctcctcgctcgatcaggtgggcccgctggca
cgcaccgtcggcgacgccgcccggctgtacgaggcgatcgccggccacgacccccgggac
gccacctcgatccacgaggccccgccgacggtggccgaccgcttggatcggggggtcgcc
gggttgcgcgtcggagtggtgcggtccttcctcgacggggacggggtcgacgccggcgtc
cgtgcacgctgcgccgaggcgatcgagcggttcgaggcgctgggtgccgaggtcgtcgac
gtcgcgctgccgcacgccgaccgggcgctgcccgcctactatctgatcgcgcccagcgag
gcgtcctcgaacctgtcgcgcttcgacggtgtccgctacgggctccgcgtcgacggcccg
accgccgaggagatgatggcgcgcacccgcgcggagggcttcggtcccgaggtcaagcgc
cgcatcatgatcgggacatatgcgctgtcggctggctactacgacgcgtactacctgcag
gcccagaaggtgcgtaccctcgtccagcgcgacctcgccacggcgtacgccgactgcgac
gtgctcgtgagcccggcgaccccgtccacggccttcgggatcggcgacaaggtggacgat
ccgctggcgatgtacctcaacgacgtcttcgcggtgccctccaacctggcggggacaccc
gccctgtcgctgccggtgggccacgacgccgacgggctgcccgtggggctgcagatcatg
gcgccgcacctcggcgagccggtgctgttccaggccgcggccgccctcgaggccgacatg
ggcttcgaggccgccccggcagccgtcgacgccgcggtcgcggcgtcctga

DBGET integrated database retrieval system