KEGG   Egibacter rhizosphaerae: ER308_10855Help
Entry
ER308_10855       CDS       T05860                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
erz  Egibacter rhizosphaerae
Pathway
erz00473  D-Alanine metabolism
erz00550  Peptidoglycan biosynthesis
erz01100  Metabolic pathways
erz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:erz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ER308_10855
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ER308_10855
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ER308_10855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:erz01011]
    ER308_10855
Enzymes [BR:erz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ER308_10855
Peptidoglycan biosynthesis and degradation proteins [BR:erz01011]
 Precursor biosynthesis
  Amino acid ligase
   ER308_10855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_3 TTL CPSase_L_D2 B12-binding ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: QBI20008
UniProt: A0A411YFL0
LinkDB All DBs
Position
complement(2332781..2333707)
Genome map
AA seq 308 aa AA seqDB search
MTGVAVVAGGLSLERDVSLRSGGRVADALTDRGHEVELLDLDSALVERLSEKTFDVVFLA
LHGKSGEDGTVQALLDLMGIPYTGPDATASAIAWDKGVFKGLSARHGIPTPDWVPVSSEA
IRDLGAASALPRIIERLGSPLVVKPAQGGAFMGVRVVDGDDDLRAGLVSALSYYDVALAE
RFVRGSEVAIAILDGEALPAVEIVPKTGQYDFSARYTHGAADFYAPARLDDRTRGEAEQV
ALRAWELAGCRDITRADLIVDADGQPWLLELDTCPGMTETSLVPMAAEAAGIGFDELCER
LVQLALRR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgacgggcgtcgcggtggttgcgggcggtctgagcctcgaacgggatgtcagcctccgc
tcggggggccgggtcgccgatgccctgaccgaccgcggacacgaggttgagctcctcgac
ctcgatagcgccctggtcgagcggttgtccgagaagaccttcgacgtggtctttctggcg
ttgcacggcaagtcgggggaggacggaaccgtccaagcgctgctggacctcatggggatc
ccgtacaccgggcccgacgcgacggcttccgcgatcgcgtgggacaagggcgtgttcaag
ggcctctccgcgcgccacgggatcccgacgcccgactgggtaccggtgagcagcgaggcc
atccgggacctcggcgccgcgtccgcgctgccccgcatcatcgagcggctgggctcgccg
ctggtggtcaagccagcgcagggcggtgctttcatgggggtgcgcgtggtcgatggggac
gacgatctccgcgcgggcctcgtcagcgcgctgagctactacgacgtcgctctggcggaa
cgcttcgtccgagggtccgaggttgccatcgccatcctcgacggggaggccctgccggcc
gtggagatcgtccccaagacgggtcagtacgacttctccgcccggtacacccacggcgcc
gcggacttctacgcgccggcacggctcgacgaccggacgcggggggaggccgagcaggtc
gcactgcgcgcatgggagctcgccggttgccgggacatcactcgggcggacctgatcgtt
gacgccgatggccaaccatggctgctcgagttggacacctgcccgggcatgaccgagacg
tcgctggtgcccatggccgccgaggcggccggcatcggtttcgacgagctgtgtgagcgc
ttggtgcagctcgcacttcgccgctga

DBGET integrated database retrieval system