KEGG   Egibacter rhizosphaerae: ER308_15725Help
Entry
ER308_15725       CDS       T05860                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
erz  Egibacter rhizosphaerae
Brite
KEGG Orthology (KO) [BR:erz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:erz01001]
    ER308_15725
Enzymes [BR:erz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ER308_15725
Protein kinases [BR:erz01001]
 Serine/threonine kinases: Other
  Bacterial family
   ER308_15725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: QBI20877
UniProt: A0A411YI50
LinkDB All DBs
Position
3414111..3415811
Genome map
AA seq 566 aa AA seqDB search
MGADRGILDRADRYPEDAPASLPSEPSRVTVLADRYELAELLGSGGMARVHAAYDRRLDR
RVAVKLVHDELLDADPNSRQRLLREARSAARLDHPNTVAVHDVGEDDGRPFVVMELVEGA
TLADRLRARGRIPADEAVAIGRAVLDALEAAHARGLVHRDVKPSNVLLPTRGGVKLADFG
IAKALDTATGGVTGTGQVVGSPRYLAPEQAAGREPSAASDLYSLGVVLYECLAGHPPFER
SNPVAVALAHQQDPLPPLRDHAPHVAPALVTTVERALAKDPADRFVDAAEMRAHLRADGE
TVAASEPTPTPGETAALRPEDAPPSGPAGSRRWQLAALLTGGVLAVIALASLLLGEDAPD
DPLGPTDEAAPGAEPEGPEVDPGTSEPDQGADAEEADEGEADARDLDELIGDLARDPGAA
GERGEDLLQELMNVREEDEGAERAEEARDAIEEVADWIADDELEAEVGREAVEALEPVGR
PDAPELAEVSALFAEVAIDRRAWGEKGEDLLSDLEDLLEAEEAEDRADDAGELINDLEEW
IADAEIDDERGRRAQQVLEPVADAAT
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgctgaccggggaatcctcgatcgggccgatcgctaccctgaggacgccccggcc
agcctgccctcggagccctcgcgcgtgaccgtcctggcggaccgctacgaactcgccgag
ctgctgggctcgggtgggatggcgcgcgtgcacgccgcctacgaccgccgtctcgatcgc
cgtgtcgcggtcaagctcgtgcacgacgagttgctcgacgcggatccgaacagccggcag
cgcctgttgcgcgaggcccggtcggcggcgcgactcgaccatcccaacaccgtcgcggtg
cacgacgtgggcgaggacgacgggcgtcccttcgtcgtcatggagctggtcgagggcgcc
accctcgcggaccggctccgggcgcgtggccggatccccgccgacgaggcggtcgcgatc
gggcgggcggttctcgacgcgctggaggccgcgcacgcccgcgggttggtgcaccgcgac
gtgaagccctccaacgtgctgctgcccacgcggggcggcgtgaagttggccgacttcggc
atcgcgaaggccctcgacaccgccaccggcggggtgaccggcactggccaggtggtcggc
agccctcgctacctcgcgcccgagcaggccgcggggcgcgagccatcggcggccagcgac
ctctactcgctgggggtggtgctctacgagtgcctggccggccacccgcccttcgagcgg
tcgaacccggtggcggtggcgctcgcccaccagcaggacccgctgccaccactgcgtgac
catgcaccgcacgtcgccccggcgctcgtgacgacggtggagcgcgcgctggccaaggac
ccggccgaccgcttcgtggatgccgccgagatgcgcgcccaccttcgagccgacggcgag
accgtcgcggccagcgagcccacgccgacgccgggggaaaccgcggcgctgcgacccgag
gatgcgcctccgtccggtcctgcgggatcgcgtcgctggcagctggccgcgttgctcacc
gggggtgtgctggccgtcatcgcgctcgcgagcctgctgctgggcgaggatgcgcccgac
gaccccctcggacccacggacgaggcggcacccggcgccgagcccgaggggccggaggtc
gaccccggcacctccgagcctgaccagggtgctgacgccgaagaggccgatgagggagag
gcggacgcccgggacctcgatgagctgatcggcgacctcgcgcgcgatccgggggcggcg
ggcgagcgcggtgaggacctcctccaagaactgatgaacgtccgcgaggaggacgagggg
gccgaacgcgccgaggaggcccgcgacgccatcgaggaggtcgcggactggatcgccgac
gacgagctcgaggcggaggtcggtcgcgaggccgtcgaggcgctcgagccggtcggccgt
cccgatgccccggagctcgctgaggtcagcgcgctcttcgccgaggtcgcgatcgatcga
cgcgcctggggcgagaagggcgaggacttgttgagcgatctcgaggacctgctcgaggcg
gaggaggccgaggaccgcgccgatgacgccggggagctgatcaacgacctcgaggagtgg
atcgccgacgccgagatcgacgacgagcgcgggcgccgagcccagcaggtcctcgagccg
gtggccgatgcagcgacctga

DBGET integrated database retrieval system