KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01888Help
Entry
ESA_01888         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
Organism
esa  Cronobacter sakazakii ATCC BAA-894
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ABU77142
UniProt: A7MK58
LinkDB All DBs
Position
1820146..1821906
Genome map
AA seq 586 aa AA seqDB search
MTVKPFGMARICDETSLRALQHRDTSFPMQAVPSRLYLTFVEFRLTAKRNPLMSRLWHQN
AVIYQIDPTRFYDSNADGWGDLRGIVEKLDYVESLGATAIWLTPFYLSPRRDNGYDVENH
TEPDPRIGSLDDVEWLIAEADKRGIRVIIELVAQHTSDAHDWFQEARKGRDNPFHDYYLW
RDTPGPDEPAPMFPTIEPHIWRWDEQAQRYYRHLFYHHEPDLNLRHPDVIQAVDHVLRFW
AEKGVAGFRVDAASHMVEQASLPGDKESGYRLFNHFYDLLTDDHPDMILLGEVDVNVSEF
EDFFGGGERLTTLLNFWINKNTILALAREEAAPLVKALNELPMPPANGGYCFWLRNHDEL
DLEDLEPEDYDFVMEKYAPDPDMRIYGRGIRRRLAPMLDGNERQQAMAHALLFSLPGTPV
VRYGAEIGMGDLLSQPERESVRTPMQWNAGPGAGFSACDPARFVEPLITDGPFRYQAINV
EEQEARDGSLLHRIRQIIAVWRTLPEICYQHFHPFTVQEKSVFAVRYQNHNVATLMLTNL
SHEAVTVDLGELNLEGAGEILADDEYPPVACSLRINGYGYRWLRVK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacggttaaaccgttcggcatggctcgcatttgtgatgaaacctctctgcgcgcttta
caacacagagacacgtcgttccccatgcaggccgtgccgtcacgcctatacttaacattc
gtcgaattccgtttaaccgccaaaaggaatccgcttatgagccgtctgtggcaccagaac
gccgtcatttaccagatagatcccacccgcttttacgacagcaacgccgacggctgggga
gacctgcgcggcattgtcgaaaagctcgactatgttgaatcgcttggcgcaaccgccatc
tggctgaccccgttttatctctcgccgcgtcgggataacggctatgacgtggaaaaccac
accgagccggacccgcgtatcggctcgctggacgatgtcgagtggctgatagccgaggcg
gataagcgcggaattcgtgtgattatcgaactggtggcacagcacacctcagatgcccac
gactggtttcaggaggcgcgcaaaggccgcgacaatccgtttcatgactactatctgtgg
cgcgacacgccaggcccggatgaacccgcgccgatgtttccgacaatcgagccgcacatc
tggcgctgggatgagcaggcgcagcgctactaccgccatctcttttaccatcatgagccg
gatctcaacctgcgccacccggacgtcattcaggctgtcgatcacgtgctgcgcttctgg
gccgaaaaaggcgtggcgggctttcgcgtcgatgccgcttcgcacatggtggaacaggcc
agcctgccgggcgataaagagagcggctaccggctgtttaaccacttctacgacctgctg
acggacgatcatccggatatgatcctgcttggcgaagtggacgtgaacgtctcggaattt
gaagatttcttcggcggcggcgaacgcctgaccacgctgcttaatttctggatcaacaaa
aacaccattctggcgctggcccgcgaagaggcggcaccgctggtgaaagcgcttaacgag
ctgccgatgccgcccgccaacggcggttattgcttctggctgcgcaaccatgacgagctg
gatcttgaagatctggagccggaagattacgacttcgtaatggagaaatacgcccccgat
cctgacatgcgcatttacgggcgcggcattcgccgccgtctggccccgatgcttgacggc
aacgaacgccagcaggcgatggcgcatgccctgctcttttcgctgcccggcacgccggtg
gtgcgctatggcgcggaaatcggcatgggcgatctgctttcacagccggagcgtgaatcg
gtgcgcacgccgatgcagtggaatgcggggccgggtgccgggttttccgcctgcgatccg
gcgcgctttgtggagccgttaattaccgacggcccctttcgctatcaggcgataaatgtg
gaagagcaagaagcgcgcgacggctcgctgctgcaccgtatccggcagattatcgccgtc
tggcgcacgctgcctgagatctgctatcagcatttccacccgttcacggtgcaagaaaag
agcgtgtttgcggtgcgctatcaaaaccataacgtcgccacgctgatgctgacgaacctg
agccatgaggcggtgacggtggatttgggcgagttaaatctggaaggcgctggcgagata
ctggcggatgatgagtatccgccagtcgcctgctcacttcgcatcaacggctatggctac
cgctggctgcgggtaaagtaa

DBGET integrated database retrieval system