KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01994Help
Entry
ESA_01994         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00480  Glutathione metabolism
esa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ESA_01994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esa02000]
    ESA_01994
Enzymes [BR:esa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ESA_01994
Transporters [BR:esa02000]
 Other transporters
  Pores ion channels [TC:1]
   ESA_01994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ABU77247
UniProt: A7MML4
LinkDB All DBs
Position
1932835..1933443
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQVFDNIAD
YHARVKARPAVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacatcattctgcgcgaa
gccaatatcgattttacgctggtggcggtggatctggccgccaaacgcacggaaaccggc
gaagactatctgactatcaacccgaaaggtcaggtgccggcgctgctgctggatgacaat
acgctgctgacagaaggcgtggctattgtgcagtacatcgcagatcttgtcccggaccgt
cagttgctcgcgccggttggcagtatgacccgttaccatacgctggagtggctgaactat
atcgccaccgagctgcacaaaggctttacgcccctgttccgcccggatacgccggatgag
tataagaccatcgcacgcgcgcagctgcagaagaaattcgcgtacgtgaatgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggatgcatatctgtttacc
gtgctgaactgggcgaaagcggtcgggcttgagatgcaggtgtttgataatatcgctgac
taccatgcccgagtgaaagcgcgccctgctgtggcagccgcgctcaaagcggaaggtctg
agcgcgtaa

DBGET integrated database retrieval system