KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_02926Help
Entry
ESA_02926         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00473  D-Alanine metabolism
esa00550  Peptidoglycan biosynthesis
esa01100  Metabolic pathways
esa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ESA_02926
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ESA_02926
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ESA_02926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:esa01011]
    ESA_02926
Enzymes [BR:esa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ESA_02926
Peptidoglycan biosynthesis and degradation proteins [BR:esa01011]
 Precursor biosynthesis
  Amino acid ligase
   ESA_02926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: ABU78155
UniProt: A7MLV3
LinkDB All DBs
Position
2879433..2880533
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKEKFDVVLLGIDKQGQWHVNDASRYLLN
AEDPARIALHRSEKNVALIPGLSEQQLIESDNRQALPQLDVIFPIVHGTLGEDGSLQGML
RMANIPFVGSGVLGSAVSMDKDVAKRLLRDAGLAVAPFITLTRANRQRITFEDVKAQLGL
PLFVKPANQGSSVGVSKVNDEAQYHAAVALAFEFDHKVVVETGIKGREIECAVLGNDSPQ
ASTCGEIVVSSEFYSYDIKYIDDQAARVVVPADIAPDVNEKIRAIAIRAFQALECAGLAR
VDVFLTPDNEVIINEINTLPGFTNISMYPKLWQASGIGYQELITRLIELALERHQADAAL
KSSITG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgcgtgggcattgtgtttggcggaaaatcagcggagcacgaggtgtcg
cttcagtcggcgaagaatatcgtcgatgcgattgataaagaaaaattcgacgtcgtgctg
ctgggcattgataaacagggccagtggcatgtgaacgacgcgtcccgttatctgctgaac
gcggaagatccggcgcgcatcgccctgcaccgctccgagaaaaatgtcgcgctgatccca
gggctcagcgagcagcaactcatcgaatcagacaaccgccaggcgctgccgcagctggat
gtgattttcccgattgttcacggcacgctcggcgaagacggctcgctgcagggcatgctg
cgcatggcgaacattccgtttgtcggctccggcgtgctcggctcggcggtgagcatggat
aaagacgtcgccaaacgcctgctgcgcgatgccggtcttgcggtcgcgccttttatcacg
ctgacccgcgccaaccgccagcgcatcacttttgaagacgtgaaagcgcagctcggcctg
ccgctgttcgtgaagcccgcgaaccagggatcttccgtcggcgtcagtaaagtgaatgac
gaagcgcagtatcacgccgccgtcgcgctggcatttgaattcgaccataaagtggtggtg
gaaaccggcatcaaaggccgtgagatcgagtgcgcggtgctcggcaatgattcaccgcaa
gcgagcacctgcggcgaaatcgtggtgagcagcgagttttactcttacgacatcaaatac
atcgacgatcaggccgcccgcgtggtggtgcctgcggatattgcgcctgacgtgaatgag
aagatccgcgctatcgcgattcgcgcgtttcaggcgctggagtgcgccgggctcgcgcgt
gttgacgtgttcctgacgccggacaacgaagtgatcatcaatgagatcaacaccctgcca
ggctttaccaatatcagcatgtatccgaagctgtggcaggcgagcggcattggttaccag
gaattgattacccgcctgattgaactggcgctggagcgccaccaggccgatgcggcgctg
aaaagctccatcaccggctaa

DBGET integrated database retrieval system