KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_04278Help
Entry
ESA_04278         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00250  Alanine, aspartate and glutamate metabolism
esa00410  beta-Alanine metabolism
esa00640  Propanoate metabolism
esa00650  Butanoate metabolism
esa01100  Metabolic pathways
esa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:esa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ESA_04278
   00650 Butanoate metabolism
    ESA_04278
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ESA_04278
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ESA_04278
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:esa01007]
    ESA_04278
Enzymes [BR:esa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ESA_04278
Amino acid related enzymes [BR:esa01007]
 Aminotransferase (transaminase)
  Class III
   ESA_04278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABU79458
UniProt: A7MH92
LinkDB All DBs
Position
4242918..4244123
Genome map
AA seq 401 aa AA seqDB search
MCGFYAEKADNATLWDVEGNEIIDFAAGIAVLNTGHRHPRVVEAIENQLRAFTHTAYQIV
PYESYVALAERINACAPIDGPAKTAFFTTGAEAVENAVKIARAYTRRPGLITFGGGFHGR
TFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGVSVDDAMASLERIFKADIAPDQVA
AIVLEPVQGEGGFNVAPPAFMEALRALCDEHGILLIADEVQSGFARTGKLFAMEHYGVKP
DLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGNPLAVAAAHAVLDVIEQENLC
QRANELGQHLQEVLNQARTYCPAIAEVRGQGSMVAVEFNDPQTGKPSPEFTQQVLTRARE
EGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALEILSRALGR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcttctatgccgaaaaagccgacaacgccaccctgtgggacgtggaaggcaac
gagattatcgacttcgcagcggggattgcggtgctgaacaccggccatcgccatccgcgc
gtggtggaggccatcgaaaaccagctgcgcgcctttacgcacacggcgtaccagatagtc
ccttacgaaagctatgtggcgcttgcggagcgcatcaacgcctgcgcgccgattgacggc
ccggcgaaaaccgcgttcttcaccaccggcgcggaagcggtggaaaacgccgtgaaaatc
gcgcgcgcgtatacccgtcgccctggcttaatcaccttcggcggcggctttcacgggcgc
acgtttatgacgatggcgctcaccggcaaagtggcaccgtacaaaatcggcttcggcccg
ttcccgggctcggtgttccacgcgcaatacccgaacgccctgcacggcgtgtcggtggat
gacgcgatggcaagcctggagcgtattttcaaagccgatatcgcgccggatcaggtggcc
gccatcgtgctggagccggtacagggcgaaggcggtttcaacgtcgcgccgccggcgttt
atggaggccctgcgcgcgctgtgcgacgagcacggcattctgctgattgccgatgaagta
cagagcggctttgcgcgcaccggcaaactgttcgcgatggagcattacggcgtgaagccg
gatctgctgacgatggcgaaaagccttgcgggcgggatgccgctctcgggcgtggtcggg
cgcgcggaagtaatggacgcgcctgcgccgggcggccttggcggcacctacgccggtaac
ccgctggcggtcgcggcagcgcacgcggtgctggatgtgattgagcaggaaaatctctgc
cagcgcgcgaacgagctgggccagcatctgcaggaggtgctcaaccaggcgcggacgtac
tgcccggcgattgccgaagttcgcgggcagggctcgatggtggcggtagagtttaacgat
ccgcagaccggcaagccgtcgcctgagtttacgcagcaggtgctgacgcgcgcccgtgaa
gaggggctgctgctgctgagctgtggcgtttacggcaacgttatccgtttcctttatccg
ctgaccattccggatgcgcagttcagcaaagcgctggagatcctctcccgcgcgctgggg
cgctaa

DBGET integrated database retrieval system