KEGG   Enterobacter lignolyticus SCF1: Entcl_2347Help
Entry
Entcl_2347        CDS       T01342                                 

Definition
(GenBank) formate dehydrogenase, gamma subunit
  KO
K08350  formate dehydrogenase-N, gamma subunit
Organism
esc  Enterobacter lignolyticus SCF1
Pathway
esc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:esc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Entcl_2347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405 DUF2300
Motif
Other DBs
NCBI-ProteinID: ADO48599
UniProt: E3G811
LinkDB All DBs
Position
complement(2479577..2480233)
Genome map
AA seq 218 aa AA seqDB search
MSKSKMIVRTKFIDRACHWTVVICFFLVAVSGISFFFPTLQWLTETFGTPQMGRILHPFF
GVLIFVVLMFMFVRFVHHNIPDRQDIPWLKGIIEVLKGNEHNVAKVGKYNAGQKMMFWTI
MSMIFVLLVTGVIIWRPYFAQYFPIQVVRYSLLIHATSAIILIHAILIHMYMAFWVKGSI
KGMVEGKVSRRWAQKHHPRWYRDVERLEAKKESAEGIR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcgaagatgattgtgcgcacgaagtttatcgatcgcgcctgccactggacg
gtggtgatctgcttctttctggtggcggtatcggggatttcgttctttttcccgacgctg
cagtggctgaccgagaccttcgggacgccgcagatggggcgcattctgcacccgttcttc
ggcgtgctgatttttgtggtgctgatgtttatgttcgtgcgtttcgtccatcacaacatc
ccggacaggcaggatattccgtggttgaaggggattatcgaagtcctgaagggcaacgag
cataacgtcgcgaaagtgggtaaatacaatgccgggcagaagatgatgttctggaccatc
atgagcatgatctttgtgctgctggtgacgggcgttatcatctggcgtccgtattttgct
caatatttcccgattcaggtcgtgcgctatagtctgcttatccatgcgacctcggccatc
attctgatccacgccatcctgatccatatgtatatggccttctgggtgaaggggtcgatt
aaagggatggttgaaggcaaggtgagccgccgttgggcgcagaagcatcatccgcgctgg
tatcgcgacgtcgaacgtctggaggcgaagaaggagagcgccgaagggatacgctaa

DBGET integrated database retrieval system