KEGG   Enterobacter lignolyticus SCF1: Entcl_3180Help
Entry
Entcl_3180        CDS       T01342                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
esc  Enterobacter lignolyticus SCF1
Brite
KEGG Orthology (KO) [BR:esc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Entcl_3180
Enzymes [BR:esc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Entcl_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 FAD_binding_3 Thi4 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin DAO
Motif
Other DBs
NCBI-ProteinID: ADO49426
UniProt: E3G4N2
LinkDB All DBs
Position
complement(3395274..3396839)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTRPVELIATLDDSAKSAEIRELLAEIAELSAKVTFKEDNALAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFMNGKA
FGQGRMTLTEIVAKVDTGAEKRAAEALNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKQHVSDYDVDVIDAQSARKLTPAAVEG
GLHHLETVSGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKVRSLKNVDIILNAQTTEVKGD
GSKVTGLDYRDRVSGDAHHVALSGIFVQIGLLPNTNWLEGAIERNRMGEIIVDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacgaatatgaaaacccagctcagggcttaccttgagaaactgacccggcct
gttgagctgattgccacgctggacgacagcgctaaatcggcagagatcagggagctgctg
gctgaaatcgccgaactgtcagcaaaagtcacctttaaagaagataacgctctggcggta
cgtaaaccctctttcctgattaccaatccggggtctgaccaggggccgcgcttcgccggt
tctccgctggggcatgagtttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcaggcgctgctggagcagattcgcgatcttgacggtgatttcgag
tttgaaacctattattcgctctcctgtcacaactgtccggacgtggtgcaggcgctgaac
ctgatggcagtgctcaacccacgcattaagcatacggcgattgacggcggtacgttccag
aacgagatcaccgatcgcaacgtaatgggcgttccggcggtctttatgaacggcaaggcg
ttcggccagggccgtatgaccctgacggaaatcgtcgccaaagtggataccggcgcggag
aaacgtgcagcagaggcgctgaaccagcgcgacgcctacgatgtgctgatcgtcggctcc
ggcccggcgggtgcggcggcggcgatttactccgcccgtaaaggtattcgtaccgggctg
atgggcgagcgctttggcggtcaggtgctggatactgtggacatagagaactatatctcg
gtaccgaaaacggaaggccagaagctggcgggcgcgctcaagcagcacgtgtccgactat
gacgtcgacgtcattgacgcccagagcgcgcgcaagctgacgcctgctgccgttgaaggc
ggtttgcaccatcttgagacggtctccggcgcggtgcttaaggcgcgcagcattatcatt
gccaccggggcaaaatggcgcaacatgaacgtgccgggcgaagatcagtaccgtacgaaa
ggcgtgacctattgcccgcactgcgacggcccgctgtttaaaggcaagcgagtggcggtc
atcggcggcggtaactccggcgttgaggcggcgatcgatctggccggtattgtcgagcac
gtgaccctgctggagtttgccccggagatgaaggccgaccaggtgctgcagaataaagtc
cgcagcctgaaaaacgtcgatatcatcctcaatgcgcagactaccgaagtgaagggcgac
ggcagcaaagtgaccggtcttgactaccgtgaccgcgttagcggcgacgcgcatcatgtc
gcgctgtcgggcatttttgttcagattggcctgttgccgaacacgaactggctggaaggc
gccattgagcgcaaccgcatgggcgaaatcatcgtcgatgcaaaatgcgaaaccagcgtg
aagggcgtgttcgcggcgggcgactgcaccaccgttccgtacaagcagataatcatcgcc
accggcgaaggcgcaaaagcctccctcagcgcatttgattatttgattcgtaccaaaacg
gcataa

DBGET integrated database retrieval system