KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_0548Help
Entry
ECSF_0548         CDS       T02077                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Brite
KEGG Orthology (KO) [BR:ese00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECSF_0548
Enzymes [BR:ese01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECSF_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: BAI54088
LinkDB All DBs
Structure
PDB: 

Position
612989..614554
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRTAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaactcaactcaaggcttaccttgagaaattgaccaagcct
gttgagttaattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgcagaactgtcagacaaagtcacctttaaagaagataacagcttgccggtg
cgtaagccgtctttcctgatcaccaacccaggttccaaccagggaccacgttttgcaggc
tccccgctaggccacgagttcacctcgctggtactggcgttgttgtggaccggtggtcat
ccgtcgaaagaagcgcagtctctgctggagcagattcgccatattgacggtgattttgaa
ttcgaaacctattactcgctctcttgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgagcgtactgaacccgcgcatcaagcacactgcaattgacggcggcaccttccag
aacgaaatcaccgatcgcaacgtgatgggcgttccggcagtgttcgtaaacgggaaagag
tttggtcagggccgcatgacgttgactgaaatcgttgccaaaattgatactggtgcagaa
aaacgtacggcagaagagctgaacaagcgtgatgcttatgacgtattaatcgttggttcc
ggccctgcgggtgcagcggcagcaatttactccgcacgtaaaggcattcgtaccggtctg
atgggcgaacgttttggtggtcagatcctcgataccgttgatatcgaaaactacatttct
gtaccgaagaccgaaggccagaaactggcaggtgcgctgaaagttcatgttgatgaatac
gacgttgatgtgatcgacagccagagcgcgagcaaactgatcccggcagcggttgaaggc
ggcctgcatcagattgaaacagcttctggcgcggtactgaaagcacgcagcattatcgtg
gcgactggtgcaaaatggcgcaacatgaacgttcctggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtagcggtt
atcggcggcggtaactccggcgtggaagcggcaattgacctggcgggtatcgttgagcac
gtaacgctgctggaatttgcgccagaaatgaaagccgaccaggttctgcaggacaaactg
cgcagcctgaaaaacgtcgacattattctgaatgcgcaaaccacggaagtgaaaggcgac
ggtagcaaagtcgtaggtctggaatatcgcgatcgtgtcagcggcgatattcacaacatc
gaactggccggtattttcgtccagattggtctgctgccgaacaccaactggctggaaggc
gcagtcgaacgtaatcgcatgggcgagattatcattgatgcgaaatgcgaaaccaacgtc
aaaggcgtgttcgcagcgggtgactgtacgacggttccgtacaagcagatcatcatcgcc
actggcgaaggtgccaaagcctctctgagtgcttttgactacctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system