KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_1000Help
Entry
ECSF_1000         CDS       T02077                                 

Definition
(GenBank) PTS system glucose-specific IIBC components
  KO
K02778  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K02779  PTS system, glucose-specific IIC component
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00010  Glycolysis / Gluconeogenesis
ese00520  Amino sugar and nucleotide sugar metabolism
ese01100  Metabolic pathways
ese02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ese00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECSF_1000
   00520 Amino sugar and nucleotide sugar metabolism
    ECSF_1000
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECSF_1000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ese02000]
    ECSF_1000
Enzymes [BR:ese01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     ECSF_1000
Transporters [BR:ese02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    ECSF_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIB MscS_TM
Motif
Other DBs
NCBI-ProteinID: BAI54540
LinkDB All DBs
Structure
PDB: 

Position
1102585..1104018
Genome map
AA seq 477 aa AA seqDB search
MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMP
LIFAIGVALGFTNNDGVSALAAVVAYGIMVKTMAVVAPLVLHLPAEEIASKHLADTGVLG
GIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLTAIFTGVVLSFIWPPIGSAIQ
TFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRY
MAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPI
EFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIV
GIGYAIVYYTIFRVLIKALDLKTPGREDATEDAKATGTSEMAPALVAAFGGKENITNLDA
CITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRNH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagaatgcatttgctaacctgcaaaaggtcggtaaatcgctgatgctgccggta
tccgtactgcctatcgcaggtattctgctgggcgtcggttccgcgaatttcagctggctg
cccgccgttgtatcgcatgttatggcagaagcaggcggttccgtctttgcaaacatgcca
ctgatttttgcgatcggtgtcgccctcggctttaccaataacgatggcgtatccgcgctg
gccgcagttgttgcctatggcatcatggttaaaaccatggccgtggttgcgccactggta
ctgcatttacctgctgaagaaatcgcctctaaacacctggcggatactggcgtactcggg
gggattatctccggtgcgatcgcagcgtacatgtttaaccgtttctaccgtattaagctg
cctgagtatcttggcttctttgccggtaaacgctttgtgccgatcatttcaggcctgact
gccatctttactggcgttgtgctgtccttcatttggccgcctattggctctgcaatccag
accttctctcagtgggctgcttaccagaacccggtagttgcgtttggcatttacggtttc
atcgaacgttgcctggtaccgtttggtctgcaccacatctggaacgtacctttccagatg
cagattggtgaatacaccaacgcagcaggtcaggttttccacggcgacattccgcgttat
atggcgggtgacccgactgcgggtaaactgtctggtggcttcctgttcaaaatgtacggt
ctgccagctgccgcaattgctatctggcactctgctaaaccagaaaaccgcgcgaaagtg
ggcggtattatgatctccgcggcgctgacctcgttcctgaccggtatcaccgagccgatc
gagttctccttcatgttcgttgcgccgatcctgtacatcatccacgcgattctggcaggc
ctggcattcccaatctgtattcttctggggatgcgtgacggtacgtcgttctcgcacggt
ctgatcgacttcatcgttctgtctggtaacagcagcaaactgtggctgttcccgatcgtc
ggtatcggttatgccattgtttactacaccatcttccgcgtgctgattaaagcactggat
ctgaaaacgccgggtcgtgaagacgcgactgaagacgcaaaagcgacaggtaccagcgaa
atggcaccggctctggttgctgcatttggtggtaaagaaaacattactaacctcgacgca
tgtattacccgtctgcgcgtcagcgttgctgatgtgtctaaagtggatcaggctggcctg
aagaaactgggcgcagcgggcgtagtggttgctggttctggtgttcaggcgattttcggt
actaaatccgataacctgaaaaccgagatggatgagtacatccgtaaccactaa

DBGET integrated database retrieval system