KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_1780Help
Entry
ECSF_1780         CDS       T02077                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00500  Starch and sucrose metabolism
ese01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ese00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECSF_1780
Enzymes [BR:ese01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECSF_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: BAI55320
LinkDB All DBs
Position
1892716..1894203
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDKNGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgcagacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcggctattcggtcggctacgactcctatgat
ttatttgatctaggtgagtttgatcagaaaggcagcatccctactaaatatggtgataaa
gcacaactgctggccgccattgacgccctgaaacgtaatgacattgcggtgctgctggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgatgaccgtacgcaaattgacgaagaaatcattgagtgtgaaggctggacgcgt
tacaccttccccgctcgtgccgggcaatactcgcagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccctgatgaagatggcatttttaaaattgttaacgac
tataccggagaaggctggaacgatcaggttgatgatgaactcggtaatttcgattatctg
atgggggagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggctttcgtcttgatgcggtcaaacatatt
ccggcatggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgttg
tttattgtggctgaatactggtcgcatgaagtcgataaactgcaaacgtatattgatcag
gtggaaggcaaaaccatgctgtttgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatgggtcgcgactacgacatgacgcagatcttcactgggacgctggtggaagccgat
ccttttcacgccgtaaccctcgttgccaaccacgacacccaaccgttgcaagccctcgaa
gcccccgtcgaaccgtggtttaaaccgctggcgtatgccttaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcacattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacgttatttttcgaccatccgaactgcatt
gcctttagccgcagtggcaccgacgaatatcccggctgcgtggtggtcatgtcgaacgga
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaaccggcaagagagcgtagtgacagacaaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgttagcgtgtgggttatcgaagaggtgatttga

DBGET integrated database retrieval system