KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_2459Help
Entry
ECSF_2459         CDS       T02077                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Pathway
ese00250  Alanine, aspartate and glutamate metabolism
ese00280  Valine, leucine and isoleucine degradation
ese00310  Lysine degradation
ese00410  beta-Alanine metabolism
ese00640  Propanoate metabolism
ese00650  Butanoate metabolism
ese01100  Metabolic pathways
ese01120  Microbial metabolism in diverse environments
Module
ese_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ese00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECSF_2459
   00650 Butanoate metabolism
    ECSF_2459
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECSF_2459
   00280 Valine, leucine and isoleucine degradation
    ECSF_2459
   00310 Lysine degradation
    ECSF_2459
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECSF_2459
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ese01007]
    ECSF_2459
Enzymes [BR:ese01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECSF_2459
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECSF_2459
    2.6.1.48  5-aminovalerate transaminase
     ECSF_2459
Amino acid related enzymes [BR:ese01007]
 Aminotransferase (transaminase)
  Class III
   ECSF_2459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAI55999
LinkDB All DBs
Structure
PDB: 

Position
2684160..2685440
Genome map
AA seq 426 aa AA seqDB search
MISNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANVLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcaattgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccactaaacgtagcggtactatcgcctttagcggtgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggacgccgtcgcaccgggcggactgggtggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgttctggggcagaagctgaaagacggattgctggcgatagccgaa
aaacacccggagatcggcgacgtacgcggtctgggggcgatgatcgccatcgagctgttt
gaagatggcgatcacagcaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagctgtag

DBGET integrated database retrieval system