KEGG   Escherichia coli O150 H5 SE15 (commensal): ECSF_3754Help
Entry
ECSF_3754         CDS       T02077                                 

Definition
(GenBank) heat shock protein
  KO
K04079  molecular chaperone HtpG
Organism
ese  Escherichia coli O150:H5 SE15 (commensal)
Brite
KEGG Orthology (KO) [BR:ese00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ese01009]
    ECSF_3754
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ese03110]
    ECSF_3754
   04131 Membrane trafficking [BR:ese04131]
    ECSF_3754
   03051 Proteasome [BR:ese03051]
    ECSF_3754
   03029 Mitochondrial biogenesis [BR:ese03029]
    ECSF_3754
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ese04147]
    ECSF_3754
Protein phosphatases and associated proteins [BR:ese01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ECSF_3754
Chaperones and folding catalysts [BR:ese03110]
 Heat shock proteins
  HSP90
   ECSF_3754
Membrane trafficking [BR:ese04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    ECSF_3754
Proteasome [BR:ese03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    ECSF_3754
Mitochondrial biogenesis [BR:ese03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    ECSF_3754
Exosome [BR:ese04147]
 Exosomal proteins
  Proteins found in most exosomes
   ECSF_3754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_3 HSP90 HATPase_c
Motif
Other DBs
NCBI-ProteinID: BAI57294
LinkDB All DBs
Position
4069755..4071590
Genome map
AA seq 611 aa AA seqDB search
MSTLQLPGSSYSTEVNLNGLIEVLSKHLYSTPVVAVRELVQNGHDAIVRRRIEQPDAPKD
NQIRVVADVAKSTITITDTGAGLTESEIHGFLATVGVGYTRMLRQQDDNTGLIGMFGLGF
LSAFVLAKEVTVLTTSWQTPDQSWKYHSTDGQKYTVTPHQASGTGTQVILTLKEEYSHLA
SNNLLNRVLSRYCILLHEPVFVGDASEPVNKLQPPWREVAPEGVTMHRALVQRKNLAFAA
QFESSFEPICTIPVVPAGMSDAVGILWIQDGATYGTSDNRNLSLFLRGMLLDDEARELLP
PWAGFIGGVIESSKLTPTASREDLQRDETWVAVQGALKEALISGLSDLAQNQPEIWRRVL
MRHNEALLGAALCDDRLFDLLKDRLQVPTSKGALLAKDLRVNNSIHILLSRDGGFEEMLF
HILQRPVARGDRYAVVPFLRRWALLYHCRIIEVGTQTGNEQLFSLAELPEEQVAYLEEHL
CDGEQLIISRFEPAVLPLVVTPDREAELKQILEQDDADKRISTAALMLARQFTSQIQKTK
TSSLYINLNNPCVMQLVTALQHHQQPAAALRLLKSLKVILCSSGNKEQQWDLHQALEDFT
QVIPVLINQGK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtacattacagttacctggcagttcatattctacagaagttaatttaaacggctta
attgaggtgctcagcaagcacctttactctacccccgtggtcgccgtacgggagctggtg
caaaacggacacgatgcgatcgtgcgccgcagaattgagcagcccgatgcgccaaaggat
aaccaaattcgagtggtggctgacgtggcgaagtccactatcaccattaccgataccggc
gcgggtctgacagaaagcgaaattcacggcttcctggctacagtgggtgtgggttatacc
cgaatgttgcgccagcaggatgacaacaccggtttaattggtatgttcggcctcggtttt
ttgtcggcatttgtactggcaaaagaggtcacggtgttgaccacatcctggcaaacgccg
gatcagagctggaaataccactctaccgacgggcaaaaatataccgttacgccacatcag
gcttcggggacggggacgcaggttattctgacgctcaaagaagagtacagccatctggcg
agtaacaatttgctgaaccgcgttctttcccgctactgcatattgctgcacgaaccggtc
tttgtcggcgatgccagcgagccggtaaataaacttcaaccaccgtggcgtgaagttgcc
cccgaaggcgtaactatgcaccgtgcgctggtacagcgtaaaaatctcgcctttgccgcc
cagtttgaatcctccttcgaaccgatttgcactattccggtggtgccagcggggatgagt
gacgcggtcgggattttatggattcaggatggcgcaacctacggcaccagcgataaccgt
aacctgtcactgtttttgcgcggcatgttactggatgacgaagcgcgtgaactgttgccg
ccctgggccggttttattggtggtgtgattgagtcatcgaaactgacgccgacggcgagc
agggaagatctccagcgggacgaaacctgggtcgcggtacagggggcgttaaaagaggcg
ctgatttctggtttgtccgatctcgcacaaaatcagccagaaatctggcggcgtgtatta
atgcgccacaacgaagcgttgctcggtgcggcgttgtgtgatgaccgtctgtttgatttg
ctcaaagatcgcttgcaggtgccaacgtcaaaaggcgcgctgctggcaaaggatttacgc
gttaataacagcattcatattctgttaagccgcgacggcggttttgaagagatgttgttc
catattctgcaacggcctgtagcccgtggcgatcgctatgcggtggtgccatttttacgc
cgttgggcgctgttatatcactgccggattatcgaagtcggtacgcaaacgggtaatgag
cagttgttcagcctggcggaattacccgaagagcaggtggcttatctggaagagcatctc
tgcgacggcgagcaattaattatctctcgcttcgaaccagcggttttaccgctcgtggtt
acgccagaccgcgaagcagaattaaaacaaattctcgaacaggatgacgcagataaacgc
atcagcaccgcagcgttaatgctggcgcggcaatttacctcgcaaatccaaaagactaaa
acatcaagtctgtatatcaatcttaataacccctgtgtcatgcaactggtgacggcctta
caacaccatcagcagccagcggcagcattacggttattaaaatcgctgaaagtgattttg
tgctccagcggtaataaagaacagcagtgggatttacaccaggcactggaagattttact
caggttattcctgtcttaattaatcaaggaaaataa

DBGET integrated database retrieval system