KEGG   Enterobacter sichuanensis: C1N69_05990Help
Entry
C1N69_05990       CDS       T06532                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
esh  Enterobacter sichuanensis
Brite
KEGG Orthology (KO) [BR:esh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1N69_05990
Enzymes [BR:esh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C1N69_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_3 Thi4 K_oxygenase Glutaredoxin AlaDh_PNT_C DAO FMO-like
Motif
Other DBs
NCBI-ProteinID: QFQ08270
LinkDB All DBs
Position
1269826..1271391
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNTLAV
RKPSFLITNPGSDRGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEELNTRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYAVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVALSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactacgatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggacgacagcgcgaaatcggcagaaatcaaggaactgctg
gcagagatcgctgaactgtcgccaaaagtgacgttcaaagaagacaataccctggcagtc
cgtaagccttctttcctgataaccaacccaggctctgatcgggggccgcgctttgccggt
tctccgctggggcatgaatttacctcgctggtgctggccctgctgtggaccggcggccat
ccgtcgaaagaagcacaggcgctgctggagcagatccgcgatatcgacggcgattttgag
tttgagacctattactcactctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggttctgaacccgcgcatcaaacacacggctattgacgggggtactttccaa
aacgaaatcaccgatcgcaacgtgatgggcgttccggcagtgttcctgaatgggcaggag
tttggccagggccgtatgaccctgacggaaattgttgccaaagtggataccggtgccgaa
aaacgggctgccgaagagctgaacacgcgtgatgcgtatgatgtcctgattgtcggttct
ggcccggcgggcgcggcggcggcggtgtactccgcacgtaaagggatccgtaccggcctg
atgggcgaacgttttggtggtcaggtactggataccgtggacattgaaaactatatctct
gtaccgaaaaccgaaggtcagaaactggccggggcactgaaggcgcacgtcagtgattac
gccgtggatgtgatcgacagccagagcgccagcaagctggttccggccgcggttgaaggt
ggcttgcatcagattgaaaccgcctccggcgctgtgctgaaagcgcgcagcattatcatt
gctaccggcgcgaaatggcgcaacatgaacgtcccgggcgaagatcagtatcgcactaag
ggcgtgacctactgcccgcactgcgatggtccgctgttcaaagggaaacgcgtggcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctggcgggtattgtggaacac
gttaccctgctggagtttgccccagagatgaaagccgaccaggttctgcaggacaaagta
cgcagcctgaaaaacgtcgacatcatcctgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaggtgaccggtctggaataccgcgaccgcgtgagtggcgatgtccacagcgta
gcgctttcggggatcttcgtgcagattggcctgctgccaaacaccacctggctggaaggg
gcgattgagcgcaaccgtatgggcgaaatcatcattgatgcgaagtgtgagaccagcgtg
aagggcgtatttgcggccggcgactgcaccaccgtgccttacaaacagatcatcatcgcc
actggcgaaggtgcgaaggcgtccctgagttcattcgactacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system