KEGG   Enterobacter sichuanensis: C1N69_14925
Entry
C1N69_14925       CDS       T06532                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
esh  Enterobacter sichuanensis
Pathway
esh00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:esh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    C1N69_14925
Enzymes [BR:esh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     C1N69_14925
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase SelA SHMT
Other DBs
NCBI-ProteinID: QFQ09913
LinkDB
Position
complement(3049108..3050208)
AA seq 366 aa
MKNIPVTQPFLPELSEFIPYLEQIWDNKWLTNNGPFHQQLEKELCEYLGVEYISLFNNAT
IALITALQALRISGEVITTPYSFIATSHSILWNGLKPVFVDIDPKTFNIDPKKIEAAITP
NTTAIMPVHCYSSPCDVEAIQEIADNYGLRVIYDAAHAFGVNYKGQSILRFGDMSILSFH
ATKVFNTFEGGAIICQDAKTKQRIDRLKNFGIADELTVTAPGINGKMSEINAAFGLVQLK
HINSAIEQRKKIDLAYREVLSSIKGITVPAPSEHSNSNYSYFPVLIEPEFRVSRDELYLE
LKRNDILSRRYFYPLISNMPMYRGIESAAVENLPLSNAISDKVLCLPIFNELSEDDFSRI
INVIRG
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaaaaatataccagtgactcaaccttttcttcctgaactcagcgagtttattccttat
cttgaacagatttgggataataaatggttgactaataatggtcccttccatcaacaactc
gaaaaagaactgtgtgagtatttgggtgtcgagtacatatctctttttaataatgcaacc
atcgcactcattaccgctcttcaggcacttcgtatttctggtgaagtgatcacgacgcca
tattccttcattgcgaccagtcattcgattttatggaatggattgaagccagtattcgtt
gatattgatcctaagacctttaatatcgatccaaagaaaatcgaagctgctattacgcca
aatacaaccgctatcatgcctgtacactgttattccagtccttgtgatgttgaagctatt
caggagattgcggacaattacggactgcgcgtgatttacgacgcagcccatgcttttggg
gtcaattacaaaggccaaagcattttacgatttggtgatatgtcaatcctcagtttccat
gcaaccaaagtattcaatacatttgaaggcggagcgattatttgtcaggatgccaagact
aaacagcggattgacagattaaagaattttggtattgcggatgaactcaccgtaacggcg
cctggaattaacggcaaaatgagtgaaatcaacgctgcctttggtctggttcagctcaag
catatcaacagcgccattgagcagcgtaaaaaaattgacctggcctaccgtgaagtgctg
tcgagcatcaaaggtattaccgttcctgcaccatcagaacattcaaacagtaactattct
tatttcccagtactgattgaacctgaattccgtgtttcgagggatgagctttaccttgag
ctaaaacgaaatgacattctttctcgtcgttatttctatccgttgattagtaacatgcca
atgtacagaggaattgaatccgcagccgttgagaatcttcctttatcaaatgctatctct
gataaggtactgtgcttacccattttcaacgaattaagtgaagatgatttctcgcgtatt
ataaatgttattcgagggtag

DBGET integrated database retrieval system