KEGG   Exiguobacterium sibiricum: Exig_0530Help
Entry
Exig_0530         CDS       T00687                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00010  Glycolysis / Gluconeogenesis
esi00053  Ascorbate and aldarate metabolism
esi00071  Fatty acid degradation
esi00280  Valine, leucine and isoleucine degradation
esi00310  Lysine degradation
esi00330  Arginine and proline metabolism
esi00340  Histidine metabolism
esi00380  Tryptophan metabolism
esi00410  beta-Alanine metabolism
esi00561  Glycerolipid metabolism
esi00620  Pyruvate metabolism
esi00625  Chloroalkane and chloroalkene degradation
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01120  Microbial metabolism in diverse environments
esi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:esi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Exig_0530
   00053 Ascorbate and aldarate metabolism
    Exig_0530
   00620 Pyruvate metabolism
    Exig_0530
  Lipid metabolism
   00071 Fatty acid degradation
    Exig_0530
   00561 Glycerolipid metabolism
    Exig_0530
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Exig_0530
   00310 Lysine degradation
    Exig_0530
   00330 Arginine and proline metabolism
    Exig_0530
   00340 Histidine metabolism
    Exig_0530
   00380 Tryptophan metabolism
    Exig_0530
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Exig_0530
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Exig_0530
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Exig_0530
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Exig_0530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ACB60011
UniProt: B1YJI1
LinkDB All DBs
Position
complement(566931..568415)
Genome map
AA seq 494 aa AA seqDB search
MQQHTKSSLNTDFTKIFINGQWRKGASDSNMTNTNPFTGETLFEISAANNDDLDDAYQSA
KVAQKEWAKVPALKRQGLIEEFLKVMYEEKETIVNWLIKESGSTRIKAEGEFLASVLIVK
EAATFPLRMHGEIRPSVVPGKENRIYRKALGVIGVISPWNFPFHLAVRSIATAIAIGNAV
VVKPATDTPVSGGLIFASLFEKAGLPKGVLNVIVGRGSEIGDSIVEHPVPRLISFTGSTE
VGRHIGELAGKHLKKTALELGGNNVFVVLDDADLDRAVESAVYSKFYHQGQICMSTNRIL
VAQSIHDEFVEKYVARVKELQFGDPSNGRTQVGPLINQSQVDRIMEEIEKTKAAGATVRV
GGEADGNVIAPTVVTGVTNDMPLAKNEIFGPVAVIIPFKDDAEALELANSLPYGLSGAVH
GSSIERATEFALQVETGMIHINDQSVNDEPHMPFGGEKDSGLGRFNGEWVLEEFSTVQWL
SVMHERRQYKPFFE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacatacaaaatcatcactcaatacagacttcactaaaattttcattaacggt
cagtggcgcaaaggcgcaagtgacagcaatatgacgaatacgaaccctttcacgggcgaa
acgctgtttgagatttcagcagctaacaacgatgacttggatgatgcttaccaatctgcc
aaagtcgcccaaaaagagtgggcaaaagtgccggcactgaaacgccaaggattgattgaa
gaatttttaaaagtcatgtacgaagaaaaagaaacaatcgtcaattggctgattaaggag
tccggcagtacacgcattaaagctgaaggcgagttccttgcctctgtcttgatcgtcaaa
gaagctgctactttcccattacggatgcacggcgaaattcgtccgtctgtcgtacctggc
aaagaaaaccggatttaccggaaagcgcttggtgtcatcggcgtcatcagcccatggaac
ttcccgttccaccttgctgtccgttcaatcgcaacagctatcgctatcgggaacgcggtc
gtcgtcaaaccggcaactgatacaccggtttcaggcggtttgattttcgccagtcttttt
gaaaaagccggcttaccaaaaggtgttttaaacgtcatcgtcggtcgcggatcagaaatc
ggcgactccatcgtcgagcatccggttccacgtttgatttcattcacgggttctactgaa
gtcggccgtcacatcggtgaacttgcaggaaaacacttgaaaaagacagcgcttgaactc
ggcggaaacaatgtattcgtcgtactggacgatgctgatcttgatcgtgccgtcgaatca
gcggtttacagcaagttctatcaccaaggtcaaatttgtatgtcgacgaaccggattttg
gttgctcaatccattcatgatgaattcgttgaaaaatacgttgcgcgtgtcaaagaactt
caatttggtgatccatcaaacggacgcacacaagtcggaccgttgatcaaccaatcgcaa
gtcgaccgcatcatggaagaaatcgaaaaaactaaagcagcgggtgcaacagtccgtgtc
ggcggtgaagcagacggaaacgtcatcgctcctacggtcgtaacaggcgttacaaacgat
atgccgcttgctaaaaacgaaatcttcggaccagtcgctgtcatcattccatttaaagac
gacgcagaggcacttgaactcgccaactcacttccttacggattaagcggtgctgttcac
ggttcttcaattgaacgcgcaacagaatttgcacttcaggttgaaacaggcatgattcac
atcaatgaccaatccgtcaacgatgagccgcatatgccgttcggcggcgaaaaagactca
ggtctcggccgcttcaacggagaatgggtccttgaagaattctcgactgtgcagtggttg
tctgtcatgcacgaacgccgtcagtacaaaccattctttgaataa

DBGET integrated database retrieval system