KEGG   Exiguobacterium sibiricum: Exig_0716Help
Entry
Exig_0716         CDS       T00687                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00564  Glycerophospholipid metabolism
esi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Exig_0716
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Exig_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 NAD_binding_8 GIDA 3HCDH_N Cation_ATPase_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACB60197
UniProt: B1YKL4
LinkDB All DBs
Position
758362..760017
Genome map
AA seq 551 aa AA seqDB search
MANQQFSSKNRAEVYNRLTREELDLLVVGGGITGAGIALDAASRGMKIGLVEMQDFAAGT
SSRSTKLVHGGLRYLKQFEIQMVAEVGKERAIVYENGPHVTTPEWMLLPMHKGGTFGPFS
TSIGLRVYDFLAGVKRSEWRSMLSAKETLAKEPLVKQDGLKGGGYYVEYRTDDARLTIEV
MKEAVAHGARVVNYTKAEEILYENGKVVGMRVTDLATGDVHEIRAKKVVNATGPWVDELR
EKDGSKVGKQLRLTKGVHVVIDQSKFPLKQAVYFDTPDGRMIFAIPRDGKAYVGTTDTFF
DKDTSHPKFTVEDQEYVLDAIHYMFPEVKVTAEDVESSWAGVRPLIYEQGKDPSEISRKD
EVWQSESGLITIAGGKLTGYRKMGEHVVDLVAKLLKKEENVAYARCATKNMPISGGHVGG
AAGYAKFLKSQAPANGLTSEEVLFLAKRYGSNVPVVLEYAAEYDAAETELPRDVYAQLHY
GINHEMVARPIDFFIRRTGAVFFDIAWARQHKEAVIKEMARHLNWTAAQTAEYTKELEIE
IEDAAHALVTE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccaacaattttcaagcaaaaaccgtgcagaggtctacaatcgattaacgcgt
gaagaacttgatctacttgtcgtaggtggaggaatcacgggagctgggatcgcacttgat
gccgcgtcacgtggcatgaagattggactcgttgagatgcaagactttgcagcgggaacg
tcaagccgttcaacgaaattggttcatggtggtttacgttatttgaaacaattcgaaatc
caaatggttgccgaagtcgggaaagaacgggccatcgtttatgaaaacggaccacacgtt
acgacaccggaatggatgttgttaccgatgcataagggcggtacgttcggaccgttcagt
acgtcaatcgggttacgtgtttatgatttcttggcaggcgttaagcgttcagagtggcgt
tcaatgttgtcggcaaaagaaacattggcaaaagagccgcttgtgaaacaagacggtcta
aaaggcggcggctactacgttgagtatcggacagatgacgcccgtttaacgatcgaagtc
atgaaagaagcggttgctcacggagcacgtgtcgtcaactacacgaaagcggaagaaatt
ctgtatgaaaacggaaaagtcgtcgggatgcgcgtgacggatctcgcgacaggggacgtt
catgaaattcgtgcgaaaaaagtcgtcaacgcaaccggcccttgggtcgatgaattgcgt
gaaaaagacggttcgaaagtcggcaaacaactccgtttgacaaaaggggttcacgtcgtc
atcgaccagtcaaaattcccgctgaaacaagccgtctatttcgatacaccggatggccgg
atgatttttgccattccacgtgacggaaaagcgtatgtcggaacaacggatacgttcttt
gacaaagacacatcacatccgaaatttacagtcgaagaccaggaatatgttctcgatgca
attcattacatgttccctgaagtgaaagtgacagccgaagatgtggaatcaagctgggct
ggtgttcgtccattgatttatgaacaaggaaaagacccgtctgaaatttcgcggaaagac
gaagtatggcagtctgaatccggtttgattacgattgccggcggaaaactgacaggctac
cgtaaaatgggcgagcatgtcgtcgatctcgtcgcaaaacttctcaaaaaagaagaaaat
gtcgcgtatgcccgttgtgcaacaaaaaacatgccgatttcaggcggtcatgtcggagga
gcagccggatacgcgaagttcttgaaatcacaagcaccggcaaacggattaacgtcggaa
gaagtcttgttccttgcgaaacgctatggttcaaacgtaccggttgttttggaatatgcg
gcagagtatgatgcggcggaaacagaattaccgcgtgatgtttacgcacaactccattac
ggtatcaatcatgagatggtagcccgtccaatcgacttcttcatccgtcggaccggcgca
gtcttctttgatattgcatgggcacgtcagcacaaagaagccgtcatcaaagagatggct
cgtcacttgaactggacagctgcacaaacagcagagtatacaaaagaactcgagattgaa
atcgaagatgcggcgcacgcactcgtcacagaataa

DBGET integrated database retrieval system