KEGG   Exiguobacterium sibiricum: Exig_2354Help
Entry
Exig_2354         CDS       T00687                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00071  Fatty acid degradation
esi00362  Benzoate degradation
esi00650  Butanoate metabolism
esi01100  Metabolic pathways
esi01120  Microbial metabolism in diverse environments
esi01200  Carbon metabolism
esi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Exig_2354
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Exig_2354
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Exig_2354
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Exig_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_2 ECH_1 ApbA NAD_binding_2 DAO FAD_binding_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ACB61804
UniProt: B1YL02
LinkDB All DBs
Position
complement(2317899..2320316)
Genome map
AA seq 805 aa AA seqDB search
MASQIGQPTTVHTTKHIQFAVIIGSGVMGAGIAAHLANAGIRTLMLDIVPKELTAQETKQ
GLTLEDAAVRSRIARDNRQKLLKQNPAPLASKQLIELIEVGNLEDDLDRLKEADWVIEVI
VERLDVKQQLFATIEPFLREDAIVSSNTSGISIEAMREGRSESFNARFLGTHFFNPPRYL
KLLELIPTRDTNPEVVQFMKQFAEERLGKGVVIAKDTPNFIGNRIGTYGLLVTMDEMKKG
GYSIGEVDSVTGPLLGRPSSATFRTLDVVGIDTFVHVANNVYDLLPDGAEKETFAVPAEM
KRLVDEGSLGAKSGQGFYKKAGKQILELDLATFEYVEKKALTEPSIGQAKALPGAKNKLK
AVVFAKDRVGALLWPIHAKTLLYSAQLTHEIADDIKAIDEAMKWGFGWKMGPFETWDALG
VEKTVAKMKQDGYDVPAWVDEMLAAGVTNFYNEDGQFYDAKTQKYVGSAVNPKEIRLRDV
RKSNGVLLENNGARLMDLGDDVAVLEFTSKSNAIGVDIMQMIEQSIDLVEKNHRGLVIAN
DGKNFCVGANLAMMLMEAEDENWFELDWIINKFQQSIQKIRYASRPIVVAPHGMTLGGGT
EISLPAARMQAALETYMGLVEVGVGLIPGGGGNVNTYRRLLENTPDGLVNLEKAAQKTFE
NVAMAKVSKSAFEARELGYVRTVDQISMNRDHLTFDAKQLVLELDRTGYTAPAHTKIPVV
GRAGKATLELATREMFYGGYISEHDLKIASKLAHVIAGGNVSFGTHVDEQYMLDIEREAF
LSLIGELKTQQRMQHMLVKGKPLRN
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcaaatcggtcagccgaccacagtacacacgacgaaacatattcaattcgcc
gtcattatcggttcaggggtcatgggggcaggaattgccgcacaccttgcgaacgcggga
atccggacattgatgcttgatatcgtaccaaaagaattaaccgcgcaggagacgaaacaa
ggattgacgctggaagatgcggcagtccgctcacgaattgcccgcgacaaccggcaaaag
ctgttgaaacaaaatccggccccactcgcttccaaacaattaattgagttaatcgaagtc
ggaaatctcgaagacgatctcgaccgtctcaaagaagcggactgggtgattgaagtcatc
gtcgaacgattggatgtcaaacaacaattgtttgcgacgattgaaccgtttttacgtgaa
gatgcaatcgtcagttccaacacatcgggtatctcgattgaagcgatgcgcgaaggacgg
tcggagtcgtttaatgcccggttcctcggcacacacttctttaacccgccgcgttacttg
aagctgcttgaactgattccgacacgcgatacgaatccggaagtcgtccagttcatgaaa
cagtttgccgaagagcgtctcggtaaaggggtcgtcatcgcaaaagatacaccaaacttc
atcggtaaccggattgggacatacggtctgctcgttacgatggatgaaatgaaaaaaggc
gggtattcgatcggggaggtcgattccgtcactggaccattgctcggtcgtccaagctcg
gcgacgttccggacgcttgatgtcgtcggaatcgacacattcgttcacgtcgcgaacaac
gtctatgatctgttaccggacggagcggaaaaagagacgtttgccgtaccggcagaaatg
aaacgattggttgacgaagggtcactcggggcgaagtcgggtcaaggcttctacaaaaaa
gccggtaaacagattctcgaactcgatctggcgacttttgaatacgttgaaaagaaagcg
cttaccgaaccgtcaatcggtcaagcaaaagctcttccgggcgctaaaaataaactgaaa
gccgtcgtctttgcgaaagaccgtgtcggtgcgttactctggccaatccatgcgaagacg
ttactgtactcggctcaactgacacacgaaatcgcggatgatatcaaagcgattgatgaa
gcgatgaaatggggcttcggctggaaaatgggaccgttcgagacgtgggatgcactcggt
gtcgagaagacggtcgcgaagatgaaacaggacggctatgacgtcccggcctgggttgat
gaaatgctggcagcaggcgtcacaaacttctataacgaagacggtcaattttacgatgcc
aagacgcaaaaatacgtcggcagtgccgtcaatccgaaggaaatccggttacgcgacgtc
cgcaaatcaaacggtgttctccttgaaaacaatggtgcccgtctgatggatctcggagac
gatgtggcggtccttgaattcacgtcgaagagtaatgcaatcggcgtcgacattatgcag
atgatcgagcagtcgattgatctcgttgaaaaaaatcaccggggactggtcatcgccaac
gacggcaaaaacttctgtgtcggagcgaacctggcgatgatgttgatggaagcggaagat
gaaaactggttcgaactcgactggatcatcaacaagttccagcaatcgattcaaaaaatc
cgttacgcgtcccgtccgatcgtcgttgcgccgcatggcatgacgcttggcggcggaaca
gagatttcacttccggcagcccggatgcaggcggctcttgaaacgtatatgggacttgtc
gaagtcggtgtcggtctgattccggggggcggcggaaacgtcaacacgtatcgtcgtctg
ctcgagaacacaccggacggactcgtcaatcttgaaaaagcggcacagaaaacgtttgag
aatgtcgcgatggcgaaagtttcgaaatcggcctttgaagcacgggaactcggttatgtc
cggaccgtcgatcagatttcgatgaaccgggatcacttgacgtttgatgcaaaacaactg
gtgcttgaactcgaccggaccggttacacggcgccggcccatacgaagattccggtcgtc
ggccgtgccgggaaagcgacgcttgaactcgcgacccgtgaaatgttctacggcggttat
atttcggaacacgatttaaaaattgccagcaaactcgcacacgtcattgccggcggaaac
gtctcgtttggcacacacgtcgatgagcagtacatgctcgatatcgaacgggaagccttc
ttgagcttgattggcgaactgaaaacacaacaacggatgcaacatatgcttgtcaaaggc
aagccgcttcgtaactga

DBGET integrated database retrieval system