KEGG   Exiguobacterium sibiricum: Exig_2359Help
Entry
Exig_2359         CDS       T00687                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
esi  Exiguobacterium sibiricum
Pathway
esi00340  Histidine metabolism
esi01100  Metabolic pathways
esi01110  Biosynthesis of secondary metabolites
esi01230  Biosynthesis of amino acids
Module
esi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:esi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Exig_2359
Enzymes [BR:esi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Exig_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH acVLRF1 MazG
Motif
Other DBs
NCBI-ProteinID: ACB61809
UniProt: B1YL07
LinkDB All DBs
Position
complement(2324162..2324464)
Genome map
AA seq 100 aa AA seqDB search
MLHELEKTVKEKIASQDEASYTNYLVKAGREKIAKKFGEEAFEVVLAGDDTLAEETADLL
YHLTVLLADRGVSFTDVEAVLNERHGTKSTFKDRPDIEKW
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgctacatgaactcgaaaaaactgtaaaagaaaaaatcgcgtcacaggatgaggcgtct
tatacgaattatctggtcaaagcaggccgcgaaaaaatcgccaagaaattcggggaagaa
gcgtttgaagtcgtcctcgcgggcgacgatacgctcgcggaagagacagcggatctgctg
tatcacctgactgtgcttctcgcggaccggggtgtttcgtttaccgacgtcgaagctgtt
ctaaacgaacgtcacggaacgaaatcgacctttaaggatcgtccggatatcgaaaaatgg
taa

DBGET integrated database retrieval system