KEGG   Exiguobacterium sibiricum: Exig_2441Help
Entry
Exig_2441         CDS       T00687                                 

Definition
(GenBank) flagellar protein
  KO
K06603  flagellar protein FlaG
Organism
esi  Exiguobacterium sibiricum
Brite
KEGG Orthology (KO) [BR:esi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:esi02035]
    Exig_2441
Bacterial motility proteins [BR:esi02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    Exig_2441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlaG Exonuc_VIII DUF3052
Motif
Other DBs
NCBI-ProteinID: ACB61891
UniProt: B1YLI6
LinkDB All DBs
Position
complement(2401295..2401651)
Genome map
AA seq 118 aa AA seqDB search
MNSINTEIRLHLPENVLPYEATRNVFVEANQEELAQDGIVILPTPQHITKFETAIEKANV
QLEAQRTGLKFVKHEKLNEFYIQVVDTNNNVVQEIPSKKELDFFAAFMEFNQLIDKRI
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaattccatcaatacggaaatccggcttcacctgcctgaaaatgtgttaccttacgaa
gcgacacggaatgtcttcgttgaagcaaatcaagaagagttggcacaggacggcatcgtc
atcttaccgacaccgcaacatattacgaagttcgaaacggccattgagaaggcaaatgtc
caacttgaagcgcagcgaacgggtttaaagttcgttaaacatgaaaaacttaatgaattt
tatattcaagtcgtcgatacgaataataacgtcgttcaagaaattccgagcaaaaaggaa
cttgattttttcgcagcttttatggaatttaatcaattgatcgataaacggatttaa

DBGET integrated database retrieval system