KEGG   Exiguobacterium sibiricum: Exig_2487Help
Entry
Exig_2487         CDS       T00687                                 

Definition
(GenBank) ABC transporter related
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
esi  Exiguobacterium sibiricum
Brite
KEGG Orthology (KO) [BR:esi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esi02000]
    Exig_2487
Transporters [BR:esi02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Exig_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 SMC_N AAA_27 SbcCD_C RF3_C
Motif
Other DBs
NCBI-ProteinID: ACB61937
UniProt: B1YLN2
LinkDB All DBs
Position
2446713..2447606
Genome map
AA seq 297 aa AA seqDB search
MLEIKAITKRFGSFTAVDDLSFEVPEGQIFGLLGANGAGKTTTFRMLLGLLQPTEGSITW
KGQPIPLSKIGYLPEERGLYPKIRVDEQLIFLAELRDMKRKDAKASLLEWLNYFQIPQYE
KMRVEQLSKGNQQKIQLISAVLHKPDLLILDEPFSGLDPVNVEQLKKAVRKLTAEGTTIV
FSSHRMDHVEELCEHVAILDHGKPVVAGYLPEIKAGYGKTRVLLTTDAPALLWDALPGIL
QVESDGTGHSLQVESKEAADLLLRHLITEGFHVERFVWDQLSLQDIFIEEVGKRYEP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaattaaagccatcacgaaacgattcgggtcgttcacagcggtcgacgattta
tcattcgaagtgccggaaggacagattttcggattacttggagcgaacggagccggaaaa
acaacgacgttccggatgttgctcggtttattgcaaccgacagaagggtcgatcacgtgg
aaaggacaaccgattcctttatcaaaaatcggttaccttcctgaggaacgtggcttgtat
ccgaaaatccgggtcgatgaacaattgatttttttagctgaactccgcgacatgaaacga
aaagatgccaaagcctctttactcgaatggctcaactacttccagattccgcagtacgaa
aagatgcgggtcgaacaattatcaaaaggaaatcagcaaaaaatccagctgatttctgcc
gtcctacataaacccgacttattaatcctcgacgaaccgttcagcggacttgatcccgtc
aacgtcgaacagttgaaaaaagcggtccggaaactgacggcagaaggcacgacaatcgtc
ttctcaagccaccggatggatcatgtcgaggaactgtgtgaacatgtcgccattctcgat
cacgggaaaccggttgtcgcagggtatcttccggagatcaaggcaggatacggcaagaca
cgtgtcttattgacgaccgatgcgcctgccctgctttgggatgcactgccgggaattctt
caagtcgaatcggacggaaccggtcacagcttacaagtcgagtcaaaagaggcggccgac
ttgctgctccgtcatttgattacagaaggattccatgtcgagcgattcgtatgggatcaa
ttatccctgcaagacatcttcattgaggaggttggaaaacgttatgaaccgtaa

DBGET integrated database retrieval system