KEGG   Exiguobacterium sibiricum: Exig_3000Help
Entry
Exig_3000         CDS       T00687                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
esi  Exiguobacterium sibiricum
Brite
KEGG Orthology (KO) [BR:esi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Exig_3000
Enzymes [BR:esi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Exig_3000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 DAO HI0933_like AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase Glutaredoxin Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: ACB62446
UniProt: B1YG62
LinkDB All DBs
Position
2985789..2987318
Genome map
AA seq 509 aa AA seqDB search
MALAADIKAQLAQYLDLLEGDLVLAVSAGTDSVSLEMSELVEEIASMSTRISIEQAALPR
TPSFSVNRVGEESGITFAGIPLGHEFTSLVLALLQVSGRAPKIDAALIEQIKGIKETYHF
ESYISLSCHNCPDVVQALNVMSVLNPNISHTMIDGGAFKQEVEAKEIMAVPTVFVNGEAF
GNGRMSLEEILAKLGTGVDASDFADKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTMSIENFISMKYTEGPKLVASLEEHVKEYGIDVMNLQRATRLEKKDLVELELE
NGAVLKTKSLILSTGARWRNIGVPGELEFKNKGVAYCPHCDGPLFEGKRVAVIGGGNSGV
EAAIDLAGLVKHVTVLEFAPELKADAVLQDRLASLPNVTVVANAQTKEITGTDKVNGITY
VERETGAEHHVELEGVFVQIGLVPNTDWLGETIERNKFGEILVDRHGATNIPGVFAAGDC
TDSAYKQIIISMGSGATAALGAFDYMIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggctttagcagcagatattaaagcacaactcgctcaatacctcgatttattggaagga
gatcttgtcctcgcggtcagcgccgggacagactccgtttctcttgagatgagcgagctc
gtcgaagaaatcgcgagcatgtcaacacgcatcagcatcgaacaggctgccttgccgcgg
acaccaagcttcagcgtcaaccgtgtcggggaagagagcggcattacatttgccgggatt
ccactcggtcacgagttcacgtccctcgtcttggcgttactccaagtcagcggtcgcgcg
ccgaaaatcgacgccgcactgatcgaacagatcaaaggtatcaaagaaacgtatcatttc
gaatcgtacatcagtctcagctgccacaactgtccggatgtcgttcaagccctaaacgtc
atgagtgtcctgaacccgaacatcagccacacgatgattgacggcggtgcctttaaacag
gaagtcgaagcaaaagaaatcatggctgtcccgactgtcttcgtcaacggcgaagcattc
ggaaacggtcggatgtcgctcgaagagattcttgcgaaactcggcacaggtgtcgatgct
tcagacttcgcggataaagacccgtacgacgttcttgtcgtcggtggcggtcctgccggt
gccagtgctgcgatttatgccgcacgtaaaggcatccggacaggaatcgtcgcagaacgc
tttggcggtcaggtcatggatacgatgagcatcgagaacttcatcagcatgaagtatacg
gaaggtccgaaactcgtggcgagtcttgaagaacacgtcaaagagtacgggatcgatgtc
atgaaccttcaacgggcgacacgtcttgagaaaaaagacctcgttgagctggagcttgaa
aacggtgcggtcttgaaaacaaagagtttgattctctcaacaggagcacgctggcgcaac
atcggtgtgccgggcgaacttgaattcaagaataaaggggttgcgtactgtcctcactgt
gacggtccactcttcgaaggaaaacgtgtcgctgtcatcggcggcgggaattccggtgtc
gaagcggccatcgatcttgccggtcttgtcaaacatgtgacggtgcttgaatttgcaccg
gaactgaaagcggacgcggtcttacaagaccgtctcgcgagtcttccgaacgtcacggtc
gttgccaacgcccaaacgaaagaaatcacgggtacggataaagtgaacggcatcacgtat
gtcgaacgcgaaacaggtgctgagcaccatgtcgagctcgaaggtgttttcgtccagatt
ggtcttgtgccaaacacagactggctcggcgaaactatcgaacgcaacaagttcggtgaa
atccttgttgaccgtcatggcgcaacgaacatcccgggtgtctttgcagccggcgactgt
acggacagtgcttacaaacagatcatcatctcgatgggatcaggtgctactgcagcactc
ggtgccttcgattatatgattcggaactga

DBGET integrated database retrieval system