KEGG   Ensifer sojae: SJ05684_b58840Help
Entry
SJ05684_b58840    CDS       T05052                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
esj  Ensifer sojae
Pathway
esj00630  Glyoxylate and dicarboxylate metabolism
esj01100  Metabolic pathways
esj01120  Microbial metabolism in diverse environments
esj01200  Carbon metabolism
Module
esj_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SJ05684_b58840
Enzymes [BR:esj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SJ05684_b58840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ASY66866
UniProt: A0A249PM30
LinkDB All DBs
Position
pSJ05684b:1862000..1863460
Genome map
AA seq 486 aa AA seqDB search
MNADAKTEIKGKERYKAGVLKYAQMGYWNGDYEPKDTDLIALFRITPQDGVDPIEAAAAV
AGESSTATWTVVWTDRLTACDQYRAKAYRVDPVPGTPGQYFCYVAYDLILFEEGSIANLT
ASIIGNVFSFKPLKAARLEDMRLPVAYVKTFKGPPTGIVVERERLDKFGKPLLGATTKPK
LGLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRYLYCMEAVNHASAVTGEVKG
HYLNITAGTMEEMYRRAEFAKELGSVIVMVDLIIGWTATQSISEWCRRNDMILHMHRAGH
GTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPLTVQGYYNVCREMKNEVDL
PRGLFFEQDWADIKKVMPVASGGIHAGQMHQLLDLFGDDVVLQFGGGTIGHPMGIQAGAT
ANRVALEAMVLARNEGRDIAHEGPEILRAAAKWCKPLEAALDTWGNISFNYTPTDSSDFV
PSVSVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgatgcaaagacagagatcaagggcaaagagcgctacaaggccggcgtgctc
aaatacgcgcagatgggctattggaacggagactacgagccgaaggacaccgacctgatt
gcgctcttccggatcacgccccaggacggggtggacccgatcgaggcggccgccgccgtt
gccggcgaaagctcgacagccacctggacggttgtttggaccgatcgcctgacggcctgc
gatcaataccgcgccaaggcataccgggtcgatcctgtacctgggacgccggggcagtat
ttctgctacgtcgcctacgacctgatcctgttcgaggaagggtcgatcgccaatctgacg
gcctcgatcatcggcaatgtcttctcgttcaagccgctgaaggcggcacggctcgaggac
atgcgcttgcccgtcgcctacgtgaagactttcaagggcccgccgaccggcatcgtcgtc
gagcgtgaacggctcgacaagttcggcaagccgctgcttggcgccaccaccaagccgaag
ctcgggctttcgggcaagaactatgggcgcgttgtctatgagggtctgaagggcggtctc
gacttcatgaaggacgacgagaacatcaattcgcagcccttcatgcattggcgcgatcgc
tacctctactgcatggaggccgtcaaccacgcctccgccgtcaccggcgaggtcaagggg
cactatctcaacatcaccgccggcacgatggaggagatgtatcgccgtgccgagttcgcc
aaggaactcgggtctgtgatcgtcatggtggatctcatcatcggctggacggcaacccaa
tcgatctcggagtggtgccgacggaacgacatgatcctgcacatgcacagagccggtcac
ggcacctatacgcggcagaagaaccacggcatctccttccgcgtgatcgcgaaatggctg
cgcctcgccggcgtcgaccacctgcacgccggcaccgccgtcggcaagctcgagggcgac
cctttgaccgtgcagggctactacaatgtctgccgcgaaatgaagaacgaggtcgacctt
ccgcgcggcctcttcttcgagcaggactgggcggatatcaagaaggtcatgccggtggca
tcaggcggcatccatgccggccagatgcaccagttgctcgatcttttcggcgacgacgtc
gtgctgcagttcggcggcggcaccatcggtcatcccatgggcatccaggcaggggccacc
gccaatcgggtcgcgctggaagccatggtgctcgcccgcaacgagggccgtgacatcgcc
catgaaggcccggagattctgcgggcggcggcgaagtggtgcaaaccgctggaagcagcc
ctcgatacctggggcaatatcagcttcaactataccccgacggactcttcggatttcgtc
ccgagcgtaagcgtcgcctga

DBGET integrated database retrieval system