KEGG   Ensifer sojae: SJ05684_c05790Help
Entry
SJ05684_c05790    CDS       T05052                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
esj  Ensifer sojae
Pathway
esj00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:esj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SJ05684_c05790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:esj02000]
    SJ05684_c05790
Enzymes [BR:esj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SJ05684_c05790
Transporters [BR:esj02000]
 Other Transporters
  Pores ion channels [TC:1]
   SJ05684_c05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: ASY62043
UniProt: A0A249P7Y4
LinkDB All DBs
Position
579552..580271
Genome map
AA seq 239 aa AA seqDB search
MIARPGGLPPDLFRLVNRCDFFSSAVRSAGGTMMLKLYYAPGTCSLASHIALEETGAAYE
AQRIDFSKAEQTKPEYLAVNPKGRVPALVTDRGTLTETPAILTYIAQSFPEAGLAPLDDP
FEFARLQSFLSYLCSTVHVAHAHARRGARWADDSAAQEAMKAKVPQNMADCFSLIESLMF
TGPFVMGETYTIADPYLFTIAGWLEGDGVDPSQFPRVLDHRNQMAERPAVAKVLTALES
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcaaggcccggcggattgccgccggacctttttcgccttgtcaaccgctgcgat
ttcttctcttctgctgtcagatcagcgggaggcacgatgatgctgaaactctattacgcg
cccggtacttgttcactcgcatcgcatatcgcgcttgaggaaacgggtgcagcctatgaa
gctcagcggatcgacttttccaaggccgagcagaccaagcccgaatatctcgccgtcaat
cccaaaggtcgcgtcccggcgctggtaaccgatcgcgggacgctgacagaaacgccggcg
atcctcacctacatagcgcagagcttccccgaagccggtctcgcgccgctcgacgatccg
ttcgaattcgcgcggctgcaatccttcctgagttatctctgctcgacggtgcacgtggcg
cacgcccatgcccgccggggcgcccgctgggcggacgattcggccgcgcaggaggcgatg
aaggcgaaggtgccgcagaacatggcggattgcttctccttgatcgagagcctgatgttc
accggcccgtttgtcatgggcgagacctacacgatcgccgatccctatctcttcaccatt
gctgggtggctggagggggatggtgtcgatccgtcgcaatttccaagagtactcgaccac
cgtaaccaaatggccgagcgtccggcggtcgccaaggtgctgaccgccttagaaagctga

DBGET integrated database retrieval system