KEGG   Ensifer sojae: SJ05684_c10940Help
Entry
SJ05684_c10940    CDS       T05052                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
esj  Ensifer sojae
Brite
KEGG Orthology (KO) [BR:esj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:esj03012]
    SJ05684_c10940
   03029 Mitochondrial biogenesis [BR:esj03029]
    SJ05684_c10940
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:esj04147]
    SJ05684_c10940
Translation factors [BR:esj03012]
 Eukaryotic Type
  Elongation factors
   SJ05684_c10940
 Prokaryotic Type
   SJ05684_c10940
Mitochondrial biogenesis [BR:esj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SJ05684_c10940
Exosome [BR:esj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SJ05684_c10940
  Exosomal proteins of breast cancer cells
   SJ05684_c10940
  Exosomal proteins of colorectal cancer cells
   SJ05684_c10940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ASY62551
UniProt: A0A249P9F5
LinkDB All DBs
Position
1047740..1048915
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYEFPGDDIPIIKGSALAALEDSDKK
IGEDAIRELMEAVDAYIPTPERPIDLPFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEV
EIVGIRPTTKTTCTGVEMFRKLLDQGQAGDNIGALLRGVDRNGVERGQILCKPGSVTPHT
QFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIIK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagcaaattcgagcgcaacaagccgcacgtgaacattggcacgattggccac
gttgaccacggcaagacgtcgctgacggcagcgatcacgaagtatttcggcgagttcaag
gcgtatgaccagatcgacgccgcgccggaagagaaggcccgcggcatcacgatttcgacg
gcgcacgtcgagtacgagacgccgaaccgccactacgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgccgcgcagatggacggtgcgatcctcgtc
gtttcggctgccgacggcccgatgccacagacgcgcgagcacatcctgctcgcccgccag
gttggcgttccggcgattgtcgtgttcctgaacaaggtcgatcaggtcgatgacgccgag
ctgctggagctcgtcgagctggaagtgcgcgaactgctgtcgtcctacgaattcccgggc
gacgacattccgatcatcaagggttctgcgctggccgctctcgaagattccgacaagaag
atcggcgaagacgcgatccgcgagctgatggaagcggtcgacgcctacatccccacgccg
gagcgtccgatcgacctgccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggcacggtcgtgaccggccgcgtcgagcgcggcatcatcaaggtcggtgaggaagtc
gagatcgtcggcatccgtccgacgacgaagacgacctgcacgggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggtgcgctgcttcgcggtgtcgac
cgcaacggcgtcgagcgcggccagatcctgtgcaagccgggttcggtcacgccgcacacg
cagttcaaggccgaagcttacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcaccaactatcgtccgcagttctacttccgcacgacggacgtgacgggcgtcgtgacg
ctgccggaaggcacggaaatggtgatgccgggcgacaacgtgacagtcgacgtcgaactg
atcgtgccgatcgcgatggaagagaagctgcgcttcgcgatccgcgaaggcggccgcacc
gtcggcgcaggcatcgtcgcctcgatcatcaagtaa

DBGET integrated database retrieval system